KEGG   Anas platyrhynchos (mallard): 101805325Help
Entry
101805325         CDS       T02816                                 

Gene name
GALNT9
Definition
(RefSeq) LOW QUALITY PROTEIN: polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00512  Mucin type O-glycan biosynthesis
apla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101805325 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:apla01003]
    101805325 (GALNT9)
Enzymes [BR:apla01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     101805325 (GALNT9)
Glycosyltransferases [BR:apla01003]
 O-Glycan biosynthesis
  Mucin-type
   101805325 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 101805325
NCBI-ProteinID: XP_027325804
Ensembl: ENSAPLG00000002528
LinkDB All DBs
Position
16
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSQELVQIVRSAERRARSRGAKVGSLAD
REAILQRLDHLEEVVYNQLNGLAKPMGLVEGPGGLGQGGMAATLRDDSHESETKYEEYGY
NAQLSDRISLDRSIPDYRPKKCKQMTYPDDLPQISVVFIFVNEALSVILRSVHSVVNHTP
SHLLKEIILVDDNSDNVELKFNLDQYVNKRYPGLVKIVRNNKREGLIRARIQGWKAATSP
VVGFFDAHVEFNIGWVEPALTRIKEDRKRIILPAIDNIKYNTFEVQQYANAAHGYNWGLW
CMYIIPPQDWLDKGDESAPIRTPAMIGCSFVVDREYFGEIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIP
MANPGVDFGDVSERIALRQRLQCRSFKWYLENVYPEMRVYNNTVTYGEVRNSKASGYCLD
QGAEEDDKAILYPCHGMSSQLVRYSSEGVLQLGPLGSTAFLPDSKCLVDDGKGRTPTLKK
CEDVLRPAQRFWDFTQNGPIISRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIK
HGRH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggcacggaaaatcaaaactttgttgacggtgaacatcttggtcttcgtgggc
atcatcctcttctccgtctactgcaggatccaggatcgctcccaggagctggtgcagatc
gtccggagcgcggagcgccgggccaggagtcgcggggccaaggtgggcagcctggcggac
agggaggccatcctgcagcgcctggaccacctggaggaggtggtctacaaccagctcaat
ggcctcgcaaagcccatgggattagttgaaggtccaggaggcttgggccaaggaggaatg
gctgctaccctgagagatgatagccatgaatcagagactaaatatgaagaatatggctac
aatgcccaactcagtgacaggatatctctggacaggtccatccctgactacagaccaaaa
aagtgcaagcagatgacctacccagatgacctgccccagatctccgtggtctttatcttt
gtcaacgaggcactgtctgttatcctgcgctccgtgcacagcgttgtgaatcacaccccc
tcgcacttgcttaaggagatcattctggtggatgacaacagtgacaatgttgagctcaaa
tttaatctggaccagtatgtcaataaaagatacccaggtctggtgaaaatagtgcgcaat
aacaagcgagaaggactgattcgagccagaatccaaggctggaaagctgcaacctctcct
gttgtcgggttctttgatgctcatgttgaattcaacattggctgggtggaacccgcactt
acccggatcaaagaagatcgaaagcggatcatcttaccagcgattgacaacatcaagtac
aacacttttgaagtgcagcaatatgccaacgcagcccatggctataactggggcctctgg
tgcatgtacataatccctccacaggactggctcgataaaggggatgaatcagctcccatc
aggacaccagccatgattgggtgctcgtttgtagtagaccgagagtattttggtgagatt
ggcctacttgaccctggtatggaggtctacggaggagaaaacatcgaattaggcatgagg
gtctggcaatgtggaggaagcatggaggtgttaccctgttctcgtgtggcacacatcgaa
cgcacaaagaaaccctacaacaacgacatcgattactatgcaaagcgcaacgccctgcgg
gctgctgaggtctggatggatgacttcaagtcgcatgtttacatggcgtggaacatcccc
atggcaaacccaggagttgattttggagatgtttctgaaagaatagctctacgacagaga
ctgcagtgccggagttttaagtggtacttggagaacgtctatcctgaaatgagggtttat
aataatacagtcacttatggagaggtacgtaacagcaaagctagtggctactgcttagat
cagggagctgaagaggatgacaaagcaatcctttatccatgccatggaatgtcctctcag
ctggtccgctacagctcagaaggcgtcctgcagctggggccgctgggctccacggccttt
ctgcctgactccaaatgccttgtcgacgacgggaagggcaggacaccgaccctgaagaag
tgcgaagacgtcctgaggccagcacagaggttctgggatttcacacagaatggtccaatc
atcagcagagacactggccgttgtctagaagtggaaatgtccaaggatgcaaattttggg
ctcagattagtcgtgcaaaggtgctcggggcaaaaatggatgattagaaactggataaaa
cacggccgacattga

DBGET integrated database retrieval system