KEGG   Anas platyrhynchos (mallard): 106018882
Entry
106018882         CDS       T02816                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
apla  Anas platyrhynchos (mallard)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 Ras_bdg_2 C1_2
Other DBs
NCBI-GeneID: 106018882
NCBI-ProteinID: XP_027323233
LinkDB
Position
13
AA seq 341 aa
MELIELRELQPEPRPGRGRLERANALRISPARRHGPAARPEPRLAAAPGTGHRFEPRRRG
LHTWCDLCGDFIWGGGRKSLQCRHCSFTCHYRCRALVRLDCSGPLGTGDEDDGTEQELEK
DTNVDEPSSWDTAELDPAQVEQRIKEYNSQINSNLFMSLNKDGSFTGFIKVQLKLARPVS
VPAAKRGPGGRPGQRGPGVKRRTSFYLPRGTVKHLHVLSHTRASEVISALLRKFTVVDDP
RKFALFERSEKDDQVFLRKLSDEEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFTLP
ELHNFLRILQREEDEQVRRVRHRYARCRREMQDALAMRAPR
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggagctgatcgagctgcgggagctgcagccggagccgcggccgggccggggccgcttg
gagcgagccaacgcgctgcgcatcagcccggcccggaggcacggccccgcggcacggccc
gagccccggctggcggcggcaccgggcaccgggcaccgcttcgagccgcggcgccgcggg
ctccacacctggtgcgacctctgcggggatttcatctgggggggcggcaggaagagcctc
cagtgccgccactgcagcttcacctgccactaccggtgccgggccctggtgcggctggac
tgcagcgggcccctgggcaccggggacgaggacgacggcaccgagcaggagctggagaag
gacacgaatgtggatgaacccagcagctgggacacggccgagctggacccggcgcaggtg
gagcagcgcatcaaggagtacaacagccagatcaacagcaacctcttcatgagcctgaac
aaggacggctccttcaccggcttcatcaaggtgcagctgaagctggcgcgtcccgtctcc
gtgccagctgccaagcgggggcctggggggcggccggggcagcgcgggccgggggtgaag
cgccgcacgtccttctacctgccccgaggcaccgtcaagcacctgcacgtcctctcgcac
acccgtgccagcgaggtcatcagcgccctgctcaggaagttcaccgtggtggacgacccc
cgaaagttcgccctcttcgagaggtccgagaaggatgaccaagtgttcctccgcaagctc
tcggatgaggagcagccgcttcggctgcgcctgctggccggccccagcgagaaggcgctg
agcttcgtgctgaaggagaacgacagcggcgaggtcaattgggacgccttcaccctgccc
gagctgcacaacttcctgcgcatcctgcagcgtgaggaggacgagcaggtgcggcgcgtc
cggcaccgctacgcccgctgccgccgcgagatgcaggacgccctggccatgagggcaccg
cggtga

DBGET integrated database retrieval system