KEGG   Anas platyrhynchos (mallard): 106020683Help
Entry
106020683         CDS       T02816                                 

Definition
(RefSeq) adenylate cyclase type 10 isoform X1
  KO
K11265  adenylate cyclase 10 [EC:4.6.1.1]
Organism
apla  Anas platyrhynchos (mallard)
Pathway
apla00230  Purine metabolism
apla01100  Metabolic pathways
apla04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:apla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106020683
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106020683
Enzymes [BR:apla01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     106020683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc AAA_16 AAA_22 DUF3767 cobW Flavi_DEAD
Motif
Other DBs
NCBI-GeneID: 106020683
NCBI-ProteinID: XP_027304264
LinkDB All DBs
Position
Unknown
AA seq 864 aa AA seqDB search
MLLLALSPGISAGQMTILSAGDRYHQQYFVCSNALDEVMKAQNLAVTSEVVVSPTCWELC
EQEQIQTRLLGGKRVLKVQRMEHMSGSERQDAAGQFDQHAKMRRLERIRHQRPPFLVSND
PKAAAKMQKYIPEAALRKLDVDMPLHLWSELRPVTSLFIQLQLSANADILDLQRSLCDAT
RMISTIISPHKGEINKSLLFDKGCTFLCVFGMSGAKLHHESTHALDSALQIFSTCSTSLR
NLEAMSIGVTSGTMFCGLCGHPERAEHTVIGHKANLGARLMVHYPRLVSCDEDTYKASCL
PSYLFKELPKTALKGVTDPGPVYQYVGITDKCIFDTDRTKRRSDCGPLLGREVEIDLFEH
SLKAYETLGQPRILAYAGILGSGKSRLLTELAFLGQAAGHRVVTMELTEANMRQPFSAIR
MLVARALGLQAGETCEDWQRTLQAKLQGVIEESRYCLLNNIFLVKFAISDQVRQMRDLQM
KRELQKTCRKVLQKTLGGEFGIFVIDNAHFIDPASWTVMWPVLQSVTLFMVMSLAPGHER
TESFFKAAADSTTSQRISCLHLEELKPAAVVQKVCQDLGVVSIPRDLARFLIQRSSGIPY
YCEELLHCLRRNNMLLFSTGRQDKKAEGNWEDLIASAVEASLIVSATSSSSAGNNSGRVC
TIRADVSLETTVLPAALKEIALAELDRITLQKQMVLKFAAIIGPVFTTQLLAHILPTCTR
QHMNYWLDGLVSDNILKWLKDTGVPRDIQDAREGPATSQQAGSGVERPSTSKETTEQQAG
VLAFCAPLLQEAAYELWPKRQRASTQRKCAAFLEKHTHKCRSCHGGDFVAFHRFAVPRTG
KTARALLPRMTGTAGRPWCSLENS
NT seq 2595 nt NT seq  +upstreamnt  +downstreamnt
atgctgcttcttgctctctcgccagggatctccgcagggcaaatgaccatactgtctgct
ggagacaggtaccatcagcagtacttcgtctgcagcaacgccctggatgaagttatgaag
gcccaaaaccttgcagttacaagtgaagtggttgtctcgcccacctgctgggagctgtgt
gagcaggaacagatccagaccaggcttcttggtggcaaacgggttctgaaggttcagagg
atggagcacatgtctggatcagaacgccaagatgctgcaggccagtttgaccaacacgcg
aagatgcggcgtttggaaaggataaggcaccaaaggccaccttttctcgtgtccaatgat
cctaaagcggcagcaaagatgcagaagtacataccagaagctgctctcaggaagctggac
gtggatatgccgctgcacctgtggtctgagctacggccagtcaccagcctctttatccag
ctgcagctttctgcaaatgccgacatactggatcttcagaggagcctctgtgatgccacc
aggatgatttcaacaatcatcagtcctcacaagggcgaaatcaacaaaagccttctgttt
gataagggctgcacattcctctgtgtgttcggaatgtctggagcaaagctgcatcacgag
agcacccatgccttggacagcgctcttcagatcttcagcacgtgctccacgtcgttgagg
aatcttgaggcaatgtctattggggtcaccagcgggacgatgttctgcggcctctgtggc
catccggagagggctgaacatacagtgattggccataaggcgaatttgggtgcccgcttg
atggtgcactaccccaggctggtgtcctgtgatgaagacacctacaaggcttcttgcctg
cccagttacctcttcaaggagttgccgaaaacagcgttgaaaggtgttacagatcccggc
cctgtctatcaatatgtggggatcaccgacaagtgcatctttgacacggatcgtaccaag
aggaggtcggactgtggccccttgctgggtcgggaggtggagattgacctctttgaacac
agcttgaaggcctacgagactttgggacagccgcgcatcctggcgtacgcaggcattctg
ggctctggaaagagccgcttacttactgagctggcctttctgggccaggccgctgggcac
agggttgtcaccatggaactgaccgaggccaacatgaggcagcccttctctgccatccgt
atgctggtggccagggccctgggactgcaggcaggtgaaacgtgcgaggactggcagcgc
accctgcaggccaagctccaaggggtgatagaagagagcagatactgcctcctcaacaac
attttcctcgtcaagtttgccatctcagaccaggttcgccagatgcgtgaccttcaaatg
aaaagggagctgcagaagacttgtaggaaagtgctacagaagacccttggaggagaattt
ggcatatttgtcatcgacaacgcccacttcatcgaccctgcctcctggactgtcatgtgg
cccgtgctccaaagcgtcacgctctttatggtgatgagcttagctcctggccacgagaga
acggagagctttttcaaagctgcagcagacagcacaacgtcccagagaatcagctgtctt
catctggaagagctgaaacctgcagctgtggtgcagaaagtctgccaggaccttggagtg
gtcagcatccccagggatctagcaaggttcctgatccaaagaagctctggcatcccatat
tactgtgaggaactgctgcactgcctgcgtcgcaacaacatgctcttgttcagcactggg
aggcaggacaaaaaagcagagggcaactgggaggacttgatcgcttctgcagtcgaggct
tcactcattgtctcagccacctcaagctccagtgctgggaataacagtggcagggtctgc
accatcagagcagacgtcagcctggagaccaccgtgctgccggccgccttgaaagagatt
gcactggctgagctggaccggatcacgctgcagaagcagatggttttgaagtttgcagcc
atcatagggccagtgtttaccacccagctgctggctcacatccttcccacttgtaccagg
cagcacatgaattattggttggacgggctggtgagcgacaacatccttaagtggctgaag
gacacaggggtgcccagagacatccaagatgctcgagaggggccggccacctctcagcag
gcagggagcggggtggagaggccgtctacaagcaaggagaccacggagcagcaggctggc
gttctggccttctgtgccccactgctgcaggaggcagcctatgagctgtggcccaagaga
cagagggccagcacgcagcgcaagtgtgctgccttcctggagaagcacacgcacaaatgc
cggagctgccacggaggggactttgtggccttccaccgcttcgccgtccccaggacgggg
aaaactgccagggctctgctgccgaggatgactggcacagctgggaggccttggtgctcg
ctggagaacagctga

DBGET integrated database retrieval system