KEGG   Anas platyrhynchos (mallard): 110354335Help
Entry
110354335         CDS       T02816                                 

Gene name
CASKIN1
Definition
(RefSeq) LOW QUALITY PROTEIN: caskin-1
  KO
K21952  CASK-interacting protein
Organism
apla  Anas platyrhynchos (mallard)
Brite
KEGG Orthology (KO) [BR:apla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:apla04131]
    110354335 (CASKIN1)
Membrane trafficking [BR:apla04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    110354335 (CASKIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Caskin-Pro-rich SAM_1 Ank_4 Ank_5 Caskin1-CID Caskin-tail SAM_2 Ank Ank_3 SH3_2 SH3_1 SH3_9
Motif
Other DBs
NCBI-GeneID: 110354335
NCBI-ProteinID: XP_027324631
LinkDB All DBs
Position
15
AA seq 1532 aa AA seqDB search
MHAWLGTAWAPWGAAGGAGWRGQPCWSSGRSPLMPESVPRFSALHHAALNGNTELISLLL
EAQAAVDIKDNKGMRPLHYAAWQGKKEPMKMVLKAGSSVNIPSDEGQIPLHLAAQHGHYD
VSEMLLQHQSNPCIMDNSGKTPLDLACEFGRVGVVQLLLNSNMCAALLEPKPGDTTDPNG
TSPLHLAAKNGHIDIIRLLLQAGIDINRQTKAGTALHEAALCGKTDVVRLLLDSGINAHV
RNTYNQTALDIVNQFTTSQASKEIKQMLRDASAALQVRAVKDYCNNYDLTSLNVKAGDVI
TVLEQHADGRWKGCIHDNRTGNDRVGYFPSSLVEAISKRTGSWETVTIPQHYQKIPLPAY
GAAVLNGDASSHPFHSLPPPPPPPPHSHQTLFSSFGYHRLSPSSADEPRYGPGSRGADMS
PSHLSPSQGGSAAPAPTEEIWVLRKPFAGGDRSSLGSTGSVASARSSGSGQSAGSGAHAL
HASSEGVKLLATVLSQKASAQDAAVGDGPAKAQDIPAGSSRSQSVASSPYAPQPAAEQQL
KKMEPPSEGKSSEAVYQWLCKFQLQLYAPNFINAGYDITTISRMTPEDLTAIGVTKPGHR
KKIASEINNLNIPEWLPEYKPANLALWLSMIGLSQYYKLLVENGYENIDFITDITWEDLQ
EIGITKLGHQKKLMLAVKKLAELQRAELGKYEPGTLKRKAAAGPEVLAIESPPPEPPECQ
SPKMTTFQDSELSSELQVAITGEGPEEPPEKPTNPSAPATARXPGLGGRTRLMSSSQELL
GDGPRAPAAAAISKSQEYLAEGAAEGPPAPPKEARPQRHGHSVKRASVPPVPGKPRQPFP
PASGHLTPPQTPGKPRPPSPQGPVVPHATAKVKPTPQLLPPGERPASPRSLPQSPTHRGF
AYVLPQPAEGEGAPPGVPVLPVSVPVLCLPPAGEGEEEPGRPKKRAHSLNRYAASDSEQE
RDELLVPDAGPYATVQRRVGRSHSVRXPAGGDKNVNRSQSFAVRPKKKGPPPPPPKRSSS
AISSAGMAEDFPKEGEGEAAAGPPAAEAESRREQRRASDLGGSVDTGSAGSVRSIAAMLE
MSSIGGGARALALQKPPGAGVPGPAKAPEGYYLQPGAPPGSPERARVATVLATVKHKEAI
GLDGEVVNRRRTISGPVTGLVAAARRERADSVRSETGAESPGERLRAERGGSPDTIPFAE
DGNLTIKQRPRPLGPARVEAGEGLSPAHRHGDLAKVEASATLKRRIRARQSQQDSVRFIL
TESDTVKRRPKAKDKEPALEPAPLAVYQNGTGTVKRRPASELSGAEPPPTPPPAARPDGP
EYPPPPAEPKKPFKPPVSPKPVLTQPAQKVPGPPVPIPKKVPIPSPGSPEVKRVHGTPPP
VSPKPTPPPTAPKPPKPHAAIQSVSAGSTPAPSPARQLGATAKPSSTPPSLCSSPAKPLS
PGAQPQQVPVKPPRSAIAGPSVDSASPELVQQKLEETSASLAAALQAVEEKIKQEDSQAA
DSAVESKSTGSILDDIGSMFDDLADQLDAMLE
NT seq 4599 nt NT seq  +upstreamnt  +downstreamnt
atgcatgcatggctggggacagcgtgggcgccctggggtgccgcagggggtgcaggctgg
aggggacagccctgctggagcagtggccgcagccccctgatgccagaatctgtccccaga
ttctctgccctgcaccatgcggcgctcaatgggaacaccgagctcatctcactgctgctg
gaggcgcaggctgcggtggacatcaaggacaacaaaggcatgcggcccctgcactatgcg
gcttggcaaggcaagaaggagcccatgaagatggtgctgaaggcagggtcctccgtgaac
atcccgtcagacgagggacagatccccctgcacctggcggcacagcacgggcactacgac
gtgtccgagatgctgctgcagcaccagtccaacccctgcatcatggacaactcggggaag
acgccgctggacttggcgtgcgagtttggccgggtcggggtggtccaactgctcctgaac
agcaacatgtgcgcggcgctgctggagcccaagccgggggacaccaccgaccccaacggc
accagccccttgcacctcgcggccaagaacggccacatcgacatcatccggctcctgctg
caagctggcatcgacatcaaccggcaaaccaaggcgggcacggccctgcacgaggcggcg
ctgtgcggcaagaccgatgtggtgcggcttctgctggatagcgggatcaatgcccacgtc
aggaacacgtacaaccagacggctctggacatcgtcaaccagttcaccaccagccaggcc
agcaaggagatcaagcagatgctgcgggacgcctcggccgctctgcaggtgcgcgccgtc
aaggactactgcaacaactacgacctgaccagcctcaacgtgaaagccggagacgtcatc
accgtgctggagcagcacgcggacgggcgctggaagggctgcatccacgacaaccggacc
ggcaacgaccgcgtgggctacttcccctccagcctcgtcgaggccataagcaagcgaaca
ggttcatgggagactgtaacaatcccccaacactaccaaaagatcccgctcccggcttac
ggggctgctgtgctaaacggtgacgcctcgtcccatccgttccattccctgcctccacct
ccacctccaccaccacattcccatcagactcttttcagttcctttggctatcacaggctc
tcccctagcagtgccgacgagccgcgttacggaccagggtcccggggggccgacatgagc
ccgtcccacctctccccgtcgcagggtggatcggccgcaccggctcccaccgaggagatc
tgggtgctgcggaaacccttcgcaggtggcgaccgcagcagcctgggcagcacgggcagt
gtggcctcggctcgcagctcggggagcgggcagagcgcgggcagcggggcgcacgccctg
cacgccagctccgagggcgtcaagctgctggcaacggtcctttcccagaaggcttctgcg
caagatgctgccgtgggcgatgggccggccaaggcgcaggacatccccgcaggctcctca
cggtcgcagagcgtggccagctccccctatgccccccagccggccgccgagcagcagctg
aagaagatggagccaccttcggaggggaagagctcagaggctgtgtaccagtggttgtgc
aagttccagctgcagctctacgcacccaacttcatcaacgccggctacgacatcaccacc
atcagccggatgacaccggaggacctcacggccatcggtgtcaccaagccgggacacagg
aagaaaatcgcctccgagatcaacaacctcaacatccccgagtggctgccggagtacaag
ccggccaacctggcgctgtggctctccatgatcggcctgtcccagtactacaagctgctg
gtggagaacggctatgagaacatcgacttcatcaccgacatcacctgggaggacctgcag
gagatcggcatcaccaagctgggccaccagaagaagctgatgctggcggtaaagaagctg
gcggagctgcagcgggccgagctgggcaagtacgagccaggcacgctgaagaggaaggca
gcagcgggcccggaggtgctggccatcgagtcccccccgcctgagccgcccgagtgccag
tcgcccaagatgaccaccttccaggacagcgagctcagcagcgagctgcaggtggccata
acgggcgaaggccccgaggaaccccccgagaagcccacgaacccctcggccccggctacc
gctcgcnccccggggctgggcggccgcaccaggctgatgagcagctcgcaggagctgctg
ggggacggcccccgagcccccgccgctgccgccatctccaagagccaggagtacctggca
gagggggctgccgagggcccccctgcgccgcccaaagaggcacgaccacaacggcacggc
cactccgtcaagcgtgccagcgttccaccagtgcctggcaagccccggcagcccttccca
cccgcctccgggcacctgacaccaccgcagacccccggcaagccacggcccccctccccg
cagggcccagtggtgccccacgccaccgccaaggtgaagcccaccccgcagctgctgccg
ccgggcgagcgccccgcgtcaccccgctccctgccccagtcgcccacgcaccgtggtttc
gcctacgtcctgccgcagcccgccgagggcgagggggcccccccgggggtgcccgtcctg
cccgtctcggtgccggtgctgtgcctgccgccggcgggcgagggcgaggaggagccgggg
cggccaaaaaagcgagcgcacagcctgaaccgctacgccgcctccgacagcgagcaggag
cgggacgagctgctggtgcccgacgcggggccctacgccaccgtccagcggcgcgtgggg
cgcagccactcggtgcggngccccgctggtggtgacaagaacgtcaaccgcagccagtcc
ttcgccgtccgccccaagaagaaggggcccccgccacccccgcccaagcgctccagctcc
gccatctccagcgccggcatggccgaggacttccccaaggagggtgagggtgaggcagcc
gctggcccccctgccgccgaggcggagagccgccgggagcagcggcgagccagcgacctg
ggcggcagcgtggacacgggcagcgccggcagtgtgcggagcatcgcggccatgctggag
atgtcctccatcggcggcggggcccgggcgctggccctgcagaaaccacctggagccggt
gtgccagggccagcaaaggcacccgagggctactacctgcagccgggagcccccccgggc
agccctgagcgcgcccgcgtggccactgtcctggccactgtcaagcacaaggaggccatc
gggctggacggggaggtggtgaaccggcgccggaccatcagcggccccgtcaccgggctg
gtggcggccgcccggcgtgagcgtgccgacagcgtgcggtcagagacgggcgctgagagc
cccggcgagcggctgcgggctgagcgcggtggctccccggacaccatccccttcgccgag
gacggcaacctcaccatcaagcagcggccgcggcccctggggccggcccgcgtggaggcg
ggcgaggggctgtccccggcccaccgccacggggacctggccaaggtggaggccagcgcc
acgctgaagcggcggatccgggcccggcagagccagcaggacagcgtccgcttcatcctc
accgagtccgacaccgtcaagcgccggcccaaggccaaggacaaggagccggcgctggag
ccggccccgctcgccgtctaccagaacggcaccggcaccgtcaagcggcgcccagcctct
gagctgagcggggctgagccgcccccaaccccgccgcccgctgcccgccccgacggcccc
gagtaccccccgccgcccgctgagcccaagaagcccttcaagccgccggtgtcccccaaa
cccgtgctaacgcagccggcgcagaaggtccctgggccaccggtgcccatccccaaaaag
gtgcccatcccgagccccggcagcccagaggtgaagcgcgtccacggcacgccgcccccg
gtgtcccccaagcccacgccgccccccacggcacccaagccccccaagccccacgccgcc
atccagtcggtgagcgcgggctccacgccggcaccgtcccccgccaggcagctgggcgcc
accgccaagccctcgagcacgccgccctcgctctgctccagccccgccaagcccctctcg
cccggcgcgcagccccagcaggtgccggtgaagccgccgcgctctgccatcgccggcccc
tccgtcgacagcgccagccccgagctggtgcagcagaagctggaggagaccagcgcgtcc
ctggctgccgcgctgcaggctgtggaggagaagatcaagcaggaggacagccaggcggca
gactctgccgtggagtcgaagagcaccgggagcatcctggacgacatcggcagcatgttc
gacgacctggcggaccagctggatgccatgctggagtga

DBGET integrated database retrieval system