KEGG   Acanthaster planci (crown-of-thorns starfish): 110973405Help
Entry
110973405         CDS       T05078                                 

Definition
(RefSeq) beta-galactosidase-like
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00052  Galactose metabolism
aplc00511  Other glycan degradation
aplc00531  Glycosaminoglycan degradation
aplc00600  Sphingolipid metabolism
aplc00604  Glycosphingolipid biosynthesis - ganglio series
aplc01100  Metabolic pathways
aplc04142  Lysosome
Module
aplc_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110973405
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    110973405
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    110973405
   00604 Glycosphingolipid biosynthesis - ganglio series
    110973405
   00511 Other glycan degradation
    110973405
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110973405
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aplc04147]
    110973405
Enzymes [BR:aplc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     110973405
Exosome [BR:aplc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110973405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 110973405
NCBI-ProteinID: XP_022079919
LinkDB All DBs
Position
Unknown
AA seq 759 aa AA seqDB search
MGRTNLIVSLSVLSFVFLNFKGMSATRSFTIDYDHNTFVKDGQPFRYISGSLHYARVHHL
YWKDRLAKMYMAGLDAVQTYVPWNLHEPKHSTYNFEGTADLETFLRMAQEAGLLVILRAG
PYICGEWDMGGLPSWLLKNPNIRLRTSDPEYLMYVDSWMGVLLPKVKPFLYANGGPIITV
QIENEYGSYPACDHKYIRHLLKLFKSHLGEDVVYFSTDGPSKGMLECGTLQGIYTTVDFG
PGGNASRYFEVQQLFEPQGPLVNSEYYTGWLDHWGQRHQSKAPTEIVNYLDDILQLGANV
NMYMFEGGTNFAFWNGANGNELAYSPQPTSYDYDAPLTEAGDPNEKYLAIRTLIGKYKKL
PPGNIPPATPKYAYGKTEMSRIATLYEALSTISPSDPISSDYPISMEDIQQDFGFVLYRT
QLQANYTLPTALTITGIRDRGYVLVDKNPIGILKRNTQVTLNMTGYINSTLDILVENMGR
LNYGCCINDSKGIISNVTLGGVVLKSWQIYSLDLSKAQPSSLKLVPETRPTSLEDLPSGP
LQIPSFFIGTLPSGPAGGPQDTFLKLTGWSKGQAFINGFNLGRYWPAEGPQMTLYVPAVV
LNATTNTLILFETEHSPCKASNPFSVCVVEFVDKPILNSTIPPVEETEEVDGSLDLGVLE
EYEWENMAVLASSSAERDTDYQEYEVDRMDEPLYVVDGIPDPVERPDSSAAAAPDVEDNA
KSDGKEDSCWLDVVKTAARFVAEVLCFFTSIPVLVWGYL
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgggacgaacaaacctaattgtatcactatcagtactgtcatttgtgttcctgaacttt
aaagggatgtcggctacacgctcattcaccatcgactacgaccataacacttttgtcaag
gatggccaaccctttcgctacatttctggctcactgcactatgctagagtccatcacctc
tactggaaagatcggctggccaagatgtacatggcaggcttggatgctgtccaaacatac
gtcccatggaacctccacgagcccaaacacagtacctacaatttcgaggggactgccgac
ctggagacatttctccgcatggctcaggaggcggggctgttggtgattctgcgagcaggg
ccctacatctgcggcgagtgggacatgggtggactaccgtcctggctgttaaaaaatcca
aacatcaggctacgcacatctgacccagaatacttgatgtacgttgattcctggatgggg
gttttactacccaaagtcaaacctttcctctatgccaacggtggacccattataacagtg
cagattgagaatgagtacggcagctacccagcctgcgaccacaagtacatccgccacctg
ctcaaactcttcaaatctcacctcggggaggatgtcgtgtacttctcaactgatgggccg
tcgaaaggcatgcttgagtgtggcaccctacagggaatatatacaactgttgatttcgga
ccagggggcaatgcaagcagatactttgaagtacagcagctgtttgagcctcaaggtcct
ctggtgaactccgagtactacaccggttggcttgaccactgggggcaacgccaccaaagc
aaggcacctactgagattgtcaattaccttgacgatatcctgcaacttggagctaacgtc
aacatgtacatgtttgaaggagggaccaactttgctttctggaacggtgccaacggaaac
gagctcgcttactccccacaaccgacgagctacgattatgacgctccactgaccgaagcg
ggcgacccaaacgaaaaataccttgccatcaggacactcattggaaaatacaaaaaactt
ccccctggcaatatcccacctgcgacaccaaagtacgcttacggcaaaacggaaatgagc
cgcattgcaacgctctacgaggcgttgagcacaatatccccctctgatccaatcagctcg
gactatccaatcagcatggaggatatacaacaggattttgggtttgtattgtatagaacc
caacttcaggccaactacacacttcccacagccctgacgatcactggcattcgagaccgt
ggatacgttctggtagataagaatcctattggaattctcaagcgtaacactcaagtcacc
ctcaacatgactggttacatcaactcaacactggatattttagtggaaaacatgggtcgg
ctgaactacggctgctgcataaatgattccaagggcatcattagcaatgtaaccctgggc
ggtgttgtcctgaaatcctggcagatctactctttagacctcagtaaggcacagccatct
tccctgaagctggtccccgagacccgcccaaccagtctggaagacctgccctctggaccg
ttgcagataccttccttcttcatcggcacccttccaagcggtccggcgggtggacctcaa
gacaccttcttaaagctgacgggttggtccaagggccaggctttcatcaacgggttcaac
ctgggtcgctactggccggccgaaggcccacagatgaccctctatgtgccggccgtcgtt
ctcaatgcaacgacaaacaccctgatactctttgagacagaacactccccctgcaaagcg
tccaatcccttttccgtatgcgtggtggaatttgtcgataagcctattctcaactcgacc
attccacctgtggaagaaacggaagaggtggacggctcgctggatcttggtgtgcttgaa
gaatatgaatgggaaaatatggccgtgttagcatcgagttcagccgagagggataccgat
tatcaggagtacgaagttgaccggatggatgagcccctgtatgtggtagatgggatacca
gaccccgtcgaaagaccagactcttcagcagcagcagctccggatgttgaggataatgcc
aaaagtgatgggaaggaggacagttgctggcttgacgtcgtgaaaactgccgcccggttt
gtggccgaggtcttgtgtttcttcaccagtatacctgtactagtctgggggtatttgtag

DBGET integrated database retrieval system