KEGG   Acanthaster planci (crown-of-thorns starfish): 110974505Help
Entry
110974505         CDS       T05078                                 

Definition
(RefSeq) NADP-dependent malic enzyme-like isoform X1
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00620  Pyruvate metabolism
aplc01100  Metabolic pathways
aplc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    110974505
Enzymes [BR:aplc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     110974505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-GeneID: 110974505
NCBI-ProteinID: XP_022081886
LinkDB All DBs
Position
Unknown
AA seq 608 aa AA seqDB search
MANLFLSARIWGASILRNPAFCKNVSLLKYRDLCRMTVRPQLRKVEQSSLSSLILAQWQA
ALRSPAFNKGTAFSLHERQALGIHGLLPPVVSTPEIQEQRALRNIRGQFSDLDRFIQLMD
LQDRNEKLFYRVLCNNLEEMMPIVYTPTVGLACQRYGLIYRRPRGLFITIHDRGHVADIL
AAWPEQNVKAVVVTDGERILGLGDLGSYGMGIPVGKLALYTAIAGVQPSQCLPIMLDVGT
NNQTLLDDPLYIGLREQRDRSSAYDELIDEFMEAVTNRYGQNCLIQFEDFGNKNAFRLLT
KYRHRYCTFNDDIQGTASVAVAGILASLRITGKKLQENIFLFQGAGEASIGIANLLIAAM
EAKGLAEDEARKRIWLLDSRGLICKDRPAGGIDSHKEPFAHPHEPMKDLEKIVQSIKPSA
LIGAAAVGGVFTEKILQDMASFNDRPIIFALSNPTSKAECTAEQAYTYTNGKCVFASGSP
FPSHKLPDGCVLYPGQGNNSYIFPGVALGVVLFGVRHITDEMFLEAAKCLASLVTDDHLK
EGRVYPPLQQVREVSLKLAVRIAEYAYETNAASRYPRPDDLETFVSSRMYDFTYESFEPQ
FYEWPKRK
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacttgtttctttcagcccggatctggggagcatcgattttaagaaatccggct
ttttgcaagaatgtgtctcttttgaagtaccgcgacctctgcagaatgacagtgcgccct
caacttcgcaaagtcgaacagtcaagtttgagttctttaatactagcgcagtggcaggcg
gcattgcgatcgcccgctttcaacaagggtacagcattctcgttacatgagcgccaggct
ctaggtattcatggccttctaccgcctgttgttagcaccccagagatacaagaacaacga
gcattacgaaacatcaggggtcagtttagtgaccttgatcgctttatccagctcatggat
ttacaagatcgtaatgagaagttgttctaccgtgtactctgcaacaatcttgaggaaatg
atgcccatcgtctatacacccactgtcggtctggcttgccaacgttatgggctcatctat
cgccgaccacgaggactcttcatcacaatacatgacagaggacatgtggcagatattcta
gctgcatggccagaacagaatgtcaaggctgttgtggttactgacggggagcgaattctt
ggcttaggggacctaggcagctatggtatgggtattcctgttggcaagctagctctctat
acagccattgctggagtccaaccatcacagtgtttacctatcatgctagatgtaggaaca
aataaccagaccttgctggatgatccactgtacattggattgcgtgagcagagagatcgt
tcttctgcctatgatgaattgattgatgagttcatggaggctgtgactaacagatatggc
cagaattgcttgatccagtttgaggactttggcaacaagaatgcattccgacttctgacc
aaataccgtcatcgatactgcacatttaatgatgacatccaagggaccgcttcagtcgct
gtagctggtatcctggccagcctgagaattacaggcaagaaactacaggagaatatattc
ctatttcagggagccggtgaggcgtctattggcattgccaacctcctcattgctgccatg
gaggcaaaaggtttggcagaagacgaggcaagaaaacgcatctggctgttggattcaagg
ggactcatctgtaaggatcgtccagcaggaggcatcgatagccacaaagagccgtttgcc
cacccccacgagcccatgaaagacctggagaagatagtgcagtccatcaagccatcagct
ctgatcggtgcagcagctgtgggaggagtcttcacagagaagatcttacaagacatggca
tcattcaatgaccgcccaatcatctttgccctcagtaatcccacaagcaaggcagaatgc
actgccgaacaggcctacacctataccaacggtaagtgtgtatttgcaagtggcagcccc
ttcccttcacacaaactcccagatgggtgtgttctatatcctggtcagggcaacaattcc
tacatcttcccaggcgtggctttgggtgtggtcctgtttggggtgaggcacattactgat
gagatgttcttggaggcagccaagtgtctggcctcccttgtgacggatgaccacctcaaa
gaggggcgtgtctaccctcccttgcaacaagttcgggaggtctccctcaagttggctgta
cgcatagctgagtacgcatatgagacaaatgcagcatcacgttatccccgcccagatgac
ttggagacgtttgtcagcagccggatgtatgacttcacttatgagtcctttgagccacaa
ttctatgaatggcctaagaggaagtag

DBGET integrated database retrieval system