KEGG   Acanthaster planci (crown-of-thorns starfish): 110974877
Entry
110974877         CDS       T05078                                 

Definition
(RefSeq) ras association domain-containing protein 1-like
  KO
K09850  Ras association domain-containing protein 1
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 DUF5663
Other DBs
NCBI-GeneID: 110974877
NCBI-ProteinID: XP_022082495
LinkDB
Position
Unknown
AA seq 531 aa
MRAADIDGTEEATSSLNSAGGRRHSHPDTTTINSNNSNTANEHSSSGLLASLWTKMSEYV
ELRTLESHPSVSSTDSGRFSGSELFDSGESVNGSAVDRQSVHSAERPVQQRNGHPKEHSQ
RNSIWNYFFGGGGSSSDSKQSSSASKSKPPSRKNSSSSQDAGHRPRSASYSSPPPPPPSS
TNFTRVKESIPTAAETEFAANGTNTWLEWNPLDEDDSDSSDSSSLVASEEEQLHQGTGEG
HDFVPVYLNFTWCDQCGGVIWGFRQCLRCTYCKYTCHYKCLNEVRLDCTESPVFKEAQSE
SPQHTIVAIENGVEDTSSLTGLSREELMWRIEEFNRKADMYPIKLESDSLIFVGSIRIYM
NLSRPISIPSGSPLPKACSTLRPYDHSVDHSKRRTSFFLPKNTYEDIQIASESTAIQVIQ
GVLSHIEVIDNCRKFALFERSDENGEVLMRKLADEEKPLLLRLLWGGDSTTKRYELRENE
TGQIEWEAFTVPELQNFLRILDKEEQDHIQQVQNKYVVYEKRLRDALNYID
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgagggctgcagatattgacggaaccgaggaggctacgtcatccctgaactctgctggc
ggtcggcgccatagtcatccagacacaaccaccatcaattccaacaacagcaacacagcc
aacgagcacagttcaagcgggttgttggcgtccctgtggacgaaaatgtccgagtatgtg
gagcttcggacgttggagtcacatcctagtgtctcctcgaccgactcgggcaggttctcc
gggtcggagctgttcgactcgggggagtccgtcaatggctcggcagttgacaggcaatct
gtgcattcagccgagcgaccagtccaacagcgaaatggccacccgaaagaacacagtcag
cggaacagtatctggaattatttctttggtggtggtggaagtagctcggattccaaacag
tcaagcagtgcatcgaaatctaaacctccatcaaggaagaactcgtcgtcttcacaggat
gcaggacaccgtccaaggagtgcatcttactcatctccacccccacctcctccatcctca
actaatttcacaagagtcaaagagagcattcccaccgctgcagagactgagtttgctgcc
aatggcaccaacacgtggctggagtggaaccccctggatgaggatgattcagacagttcg
gattcatcatcattagttgcatcggaggaggagcagttgcaccaggggacgggagagggg
catgactttgttcctgtatatttaaacttcacatggtgtgatcaatgtggtggggtcata
tggggctttcgtcagtgcctacgctgtacatactgcaagtatacatgtcactacaagtgc
ctgaatgaggtgagacttgattgcactgagtcacctgtcttcaaggaagctcagtcagaa
tcaccacagcacaccattgttgccattgagaatggtgttgaggacactagttcactgact
gggttatccagagaggaactcatgtggagaattgaagagttcaacaggaaggcagatatg
tacccgatcaaactggagagtgacagcttaatatttgtgggtagcatccgaatatatatg
aacctctctcgaccgatcagcattcccagtggttctccactccccaaggcgtgcagtacg
ctgcgcccctatgaccacagcgtggaccacagcaagagacggacgtccttctttcttccc
aaaaatacctatgaggatattcagatagcgagtgagtccaccgccattcaggtcatccaa
ggcgttctgagtcacattgaagtcatagacaactgccgcaagtttgctctctttgagcgc
tcagatgaaaatggtgaagtgttgatgaggaaactagctgatgaggaaaagcctttgttg
cttcgattgttgtggggcggggatagcacaacaaagcgatatgagttacgagagaatgaa
acagggcagattgagtgggaggcattcacggtgcctgagctgcaaaacttcctacgtatt
ttggacaaggaagagcaagatcacattcagcaagtgcagaacaagtacgtggtctatgag
aaacgccttcgggatgccttgaattatattgattag

DBGET integrated database retrieval system