KEGG   Acanthaster planci (crown-of-thorns starfish): 110975930Help
Entry
110975930         CDS       T05078                                 

Definition
(RefSeq) cleavage and polyadenylation specificity factor subunit 6-like
  KO
K14405  pre-mRNA 3'-end-processing factor FIP1
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    110975930
Messenger RNA biogenesis [BR:aplc03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     110975930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fip1
Motif
Other DBs
NCBI-GeneID: 110975930
NCBI-ProteinID: XP_022084503
LinkDB All DBs
Position
Unknown
AA seq 766 aa AA seqDB search
MADEDEEQWLYGDTEEDTAELPAEVENEASSSSLPAEAEPLVSPTAEPDAPPLVLADDGP
PELEDKEEGEMDDEDMGRTADHDSDEDSEDDDDVQVTIGDIKAAPAYSSYGGQPAHSLSK
TSTYHKTSATAPQAPAVTVPKVPVKGVDLEAEGTINGVGVYSFDLDSVVDKPWRKPGADL
TDYFNYNFNEETWKNYCNKQHSLRGDPSGKSFSHDSANSKDSQGSTAKVDIKPSPTRQGS
RSEYPSPINVIGSIAGRRRPNEADQKAMQSIKVVGSDEKMTNSFNKTGMSGPPPPASPNQ
PPPSSNYGPRSMQGPPPNMQGPRPMGMGPMGGPPPPQRPPGGPPPMQRPPGGPPPPGPRG
PPPGPGGPPPPRGPGPMGGPMGGPRGPPRPGGPPPPGRMPPPHSGPPPPRMNMPHPNMSG
PPPQNYGPPPQRFDGPPPRQNFPGPRGPPPGPGGPMPPGQNGPPRPPMNMPPPNMNMPPP
QGGSYPHPTGGMPPPQQSGMPSHSLAGPMPPPNQMGGTGPIGPGPGPGSQGIDARRPPPN
FGERPPYFNESTSQNQSYKPQYNQGLSPPSQGPSPPDMWDRGPSITPTPYFRGQSPTSES
DISTSSGEDGYRHKEVRSYRREDYDRKSPDRSRSDRDRSRDRERDRDRDRDRSRPRDRDR
DRDRHRDRDRDRDRDRDRDRDRRQREKDRDRDRERDRGRDSRDGKESRRRRHDSDEAHRS
SRHRHSKRSRRDHEEKETDGKKDDERSEDTAKDDGNSSLVPEYSSE
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgaggacgaagaacaatggttgtatggagacacagaggaggacacagcagag
ctgccagcagaagttgagaatgaggcttcttcgagctcactccctgccgaggcggagccg
ctggtcagtccaactgcagagccagatgccccacctctagtgctagctgacgatggcccg
cctgagctggaagacaaagaggaaggagaaatggatgacgaggacatgggacgaactgca
gatcacgacagcgatgaagacagtgaagatgatgacgacgtgcaggtgaccatcggggac
atcaaggcagcccctgcctacagctcatacggaggccagcctgcccacagtctgagcaag
acttcaacgtaccacaagacctcagctacagcccctcaagcaccagcggtgaccgttcca
aaagtaccagtcaaaggggtggatttggaggcggaaggtaccattaatggagtaggggtg
tactcctttgacctggattcagtcgtggacaagccctggaggaaaccaggtgccgatttg
acagattatttcaattacaacttcaacgaggagacgtggaagaactattgcaacaagcag
cacagcctacgtggcgatccttctggcaagagcttctcgcacgactctgcgaactctaaa
gacagccaaggttcaactgccaaggtagacatcaagcccagcccaacacggcagggtagc
cgtagtgagtatccaagcccaatcaatgtgattggctccatagccggtagacggagaccg
aatgaagctgatcagaaggcaatgcagagcatcaaggtggtgggaagtgatgaaaagatg
accaatagctttaacaagactggtatgtcggggccacctcctcctgcaagccccaaccag
cccccacccagctccaactacggcccgcgaagcatgcaggggccacctccaaacatgcag
ggcccccgcccaatgggaatgggccccatggggggtcccccacccccacagagaccccct
gggggaccaccaccaatgcagagaccccctgggggcccaccaccccctggtccccgtggg
ccacccccggggcctgggggaccaccgccacccagggggcctgggcccatggggggtccc
atgggaggccccaggggaccgccgaggcctgggggtccacccccacctggaaggatgcca
cctccacattcaggccctccaccacccaggatgaacatgcctcatcccaatatgtctggt
ccacccccacagaattacggacctcctcctcagcgctttgacggaccccctcctagacag
aatttccctggaccgcggggccctcctcctggtcccgggggccccatgcctcccggccag
aacgggcccccaaggccccccatgaacatgccgccacccaacatgaacatgcccccaccc
caggggggcagttacccccaccctacagggggcatgcctccgcctcagcagagtggcatg
ccctcgcattccctggcgggtcccatgccgccccctaatcagatgggtgggacagggccg
atcggtccgggccccgggccaggatctcaggggattgacgcccggagaccgccgcctaac
tttggggaaaggccgccttatttcaatgagtccactagccagaaccagtcctacaaaccc
cagtacaaccaggggctctcgcctccaagccaaggcccctcgccccctgacatgtgggac
agagggcccagcattacacccacgccctacttcagggggcagagcccaactagcgagagt
gacatcagcacgagtagtggtgaggacggctatcgtcacaaagaagtacggagctaccgt
cgggaagattacgacagaaagtctccagaccgcagccggtcagatcgggaccggtcgcga
gaccgggagagggatcgcgacagggaccgggaccggtcgcgccccagggaccgagacagg
gaccgcgatcggcaccgggacagggaccgcgaccgagacagggaccgggacagggaccgg
gacaggaggcagcgggagaaagacagagacagggacagagagcgagacagggggagagac
agccgggacggcaaggagtcgaggagaagacgacatgatagcgatgaggcccataggagt
tcccgtcaccgccacagcaagcgatcacgacgggaccatgaggagaaagagacagatggg
aagaaagatgacgaacgctcagaggacacggctaaagacgatggcaacagctcattggtg
ccagagtactcctcagaataa

DBGET integrated database retrieval system