KEGG   Acanthaster planci (crown-of-thorns starfish): 110976374Help
Entry
110976374         CDS       T05078                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EHMT2-like
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110976374
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aplc03036]
    110976374
Enzymes [BR:aplc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     110976374
Chromosome and associated proteins [BR:aplc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     110976374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_5 SET Ank_3 Ank Pre-SET
Motif
Other DBs
NCBI-GeneID: 110976374
NCBI-ProteinID: XP_022085273
LinkDB All DBs
Position
Unknown
AA seq 1397 aa AA seqDB search
MAADWKDVESKVIEELADHRFVFCSDEVGVSGEDRKMLQKRSSRKQFQDLSFRDSGKRSI
ERVPVANDLRSQKGRESQNALRPQRQSDSEREERNSVQNSKPPAKGMEERVPMMTQPQGG
MKNTGMPPQQAAARKTVSSAMTKKRTQLIKKLMTTSSKLTARKSGPNVNRLQLQKRNMQL
NAGKRAALPVRFNFRRSTQMEMPKRQLAGKQCGHVAPDKVNHSHGAQLVNERGILTTLKT
EPVQSSVPSNVEIKGSVTDQPDKPKQHATARKSWSTIKNLTNSPTTPQGSLKKPHQVRFA
NNKPGKVKTKESRKLIFDLNKSRKRNAAVAAETLPAAKKLKSASMAIPPVVQRAIMLGLV
TTSSFRPGMTVANPVDGDTILHQKDSNKLHVQRTATQDYSPDNQKTDSDDSAPGTGHSLM
VGQHEKMRNYRDRDSNLMESPDSSQVDDQDIFMDDDPPKLISSRDLEAQDVSGSEETPEL
DSQAPPDITPAQDMHQTLPSSGDIQSADRDNPTPIPGTTASSCDPRHALAADFPVGTAGS
ATPDSSAKETCPSDIKKKKRPRTHTHFGMKRHRVGKPPNKIATYDSDSTDIQSEAGSENQ
SPGQKKKRSSSTSTMASLESDAEFSAQGSLDGHINSSQHLQSELPLCSCRMEQKGPSSVI
LSTCRALEVIDSELVECTNKINTGKLHRPSSRVPYGGFCAEHRTLMTEHKCCPGCGCFCT
TGVVVICNPEGNDKKSHHFHRECIMDLAGALYCPHCGSTSGLQEISIPSNGNMATLRKIP
KSNVISGVVKLPKSLLGKLTGCCDDEESLDAEVKELEEPKQHGPRAKMSITKKDKPESVN
EEQSYAELLSKSVILKSGTILTSKPLPPGPKRDVLESAMEYLNIDSPKRIRFFPKNMYNA
SLQGEMGKVLQMLGKIKQGEEKIGKISHMAVENGYNDCMKYLIKHGAAVEHRDDEGMTIL
HLAAKTGNLEAVKHIMSLRKINSNSQDDGGWTPIIWAAEYKHIPVVKYLIERGADPNVRD
KEGNSGLHWAVFSGSEDVAELFLNRHCDVYAPNIHGDTPLHIASRENHYGCVTMLLLRNA
NIAVTNQEGETPLDCAKPNSDVALALQVNEKMKLAAGNRAIRTEKIISRDISRGLESLPI
TAVNAINDDPVPTDFHYVAQSCETKPLSINHSIKNPPMCTCTNEDCYTDSCECANNSVQC
WYDSDGRLFPDFDYHEPPLIFECGPGCKCWRSCRNRVVQNGIRCHLQLYRTAKIGWGVRV
TQDVPQGTFICEYSGELISDAEADKREDDSYLFDLDNEEREVYCIDARYYGNVSRFINHQ
CDPNIVPVRVFIEHRDISFPRIAFFASRDIKAQEELGFDYGDKFWAIKSKFFTCCCGSEH
CKHSEGTSGSDEGDPDS
NT seq 4194 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgattggaaggatgtggagtcaaaggtcatagaagagctagcggaccatcgt
tttgtcttttgttctgatgaggttggagtgagtggtgaagataggaaaatgcttcagaag
cggtcatcgcgtaaacagtttcaggatctgtcattcagagactccggcaaaaggagcata
gaaagggttccagtggcaaatgatctacgctctcagaaaggtcgggaatcccagaatgct
ttgcgccctcagagacagagtgatagtgagagggaagagaggaactcggttcagaatagt
aaaccaccagcaaaggggatggaagaacgagtaccaatgatgactcagccacaaggagga
atgaaaaacacaggaatgcctcctcaacaagctgctgctcgtaagacagtttcctcagct
atgacaaagaaacggacacagttgattaaaaagttgatgacaacctcgtcaaaactcact
gcccggaaatcaggcccaaatgtcaacaggttgcaattacagaagagaaacatgcaactg
aatgcaggcaaacgagctgcgttaccagtcaggtttaactttcgaaggtccactcaaatg
gagatgccaaagaggcagttggctggaaaacaatgtggtcatgtagctccagataaggtg
aatcattcccacggtgcacaacttgttaatgaaagaggtatcttgactactctaaaaaca
gaaccagtccaaagcagtgtaccatcaaatgtggaaataaaaggtagtgtgacagaccaa
cccgataaaccaaaacagcatgctacagcgcggaaatcgtggtctacaataaagaattta
accaacagtcccactacaccacaaggctctctgaaaaaaccgcaccaagttcgatttgcc
aacaataaaccagggaaggtaaaaaccaaagaaagtagaaaattgatttttgatcttaat
aagagtcgcaaacggaatgctgctgttgcagctgaaactttacccgcagccaagaaattg
aaatcggcatcaatggcaataccacccgttgtacaacgagccattatgcttggcttagtc
acaacatcatcatttcgaccaggcatgacagtcgccaatccagttgatggagatacaatc
ttacatcagaaagattccaacaaactacacgtgcaaagaacagcaactcaggattattcc
cccgataatcaaaagactgactctgacgattcagcacctggtacaggacatagcctaatg
gtaggacaacacgaaaaaatgagaaactatagagacagagacagcaacttgatggagtct
cctgactcatctcaagttgatgatcaagacattttcatggatgatgatcctccgaaactc
atcagtagtagggatcttgaagctcaagacgtgagtggcagtgaagaaacacctgaactt
gacagccaagcacctcctgatattacacctgctcaggacatgcaccaaacactgccctct
agtggtgatatacagtcggcagatcgtgacaatcccaccccaattccaggcaccacagcg
tcatcctgtgatccccgtcatgctcttgctgcagatttccctgtcggtactgctgggtct
gctacgccagattcatcggccaaggagacctgtccatctgacatcaagaagaagaagcgc
cctcgtacacacacgcattttggtatgaagcggcatcgagttggcaaaccaccaaataaa
atcgctacctacgattctgattcaactgatatccagagtgaagcgggcagtgaaaatcag
tcaccaggtcagaagaagaaacgatctagtagcacctcaactatggccagcttagaatca
gatgcagagttttcagcacagggtagtcttgatggacacatcaatagcagtcaacatctc
cagtctgagcttcctctttgctcttgccgcatggagcagaaaggtccttcatctgtaatc
ttatccacctgtcgagcgttggaagttattgacagtgagctggttgagtgtacaaataag
atcaatacaggcaagttacatcgtccatcttccagagttccttatggaggcttctgcgct
gagcacaggacactgatgactgaacacaagtgttgcccaggatgtggctgtttttgcaca
acaggagtcgtggtcatctgcaacccagaaggaaatgacaaaaaatcccatcactttcat
cgtgagtgtatcatggacttagcaggagccctctattgtccacattgtggcagtacctct
ggactacaagaaatttcaatcccatccaatgggaatatggccacgctacgcaagatacca
aagtccaatgtcatcagtggtgttgtcaagttacccaagtcgttgctagggaaactaact
ggttgctgtgatgatgaggaatcactggatgctgaggttaaggaacttgaggaacccaaa
cagcatggaccaagagcaaagatgagcataaccaagaaagataaacccgagtcagttaat
gaagaacaaagctatgctgaattactatcgaagagtgtcatcctgaaatcaggaacgatc
cttacctcaaagccattaccacctggtccaaagagagatgtcctggagtcagccatggaa
tacctcaacatagattcgcctaaacgaatccgtttcttccccaagaacatgtacaatgca
tccttgcaaggcgaaatgggcaaagtacttcagatgcttggtaagatcaaacaaggggaa
gaaaaaattggcaaaattagtcacatggctgttgagaatgggtacaacgactgtatgaaa
tacctgataaaacatggtgctgctgtggaacacagggatgacgagggtatgactatcctt
caccttgcggctaagactggcaatttggaggctgttaaacacatcatgagtctcaggaaa
atcaattccaattcccaggacgatggtggttggacaccaatcatctgggctgccgagtac
aaacacattccagtcgtgaagtatctcatagaacgaggtgctgatccgaatgtcagagac
aaggagggcaattcaggtcttcattgggctgtcttctctggatcagaagacgtcgctgag
cttttcctcaatagacattgtgatgtctacgcacccaacattcatggagacacaccacta
cacattgcctccagagagaatcactacggctgtgtcaccatgctgcttctgcgaaatgcc
aacattgcagtcacaaaccaggaaggtgagacacctctagattgtgccaagccaaactcg
gatgtagccttagctttgcaggtgaatgagaagatgaaactggctgctggtaacagagct
atcagaacagaaaagatcatcagtcgtgatatatcccgtggtttggaatcacttcccatt
actgctgtcaatgccatcaatgatgaccctgtgccaacagactttcactatgttgcccag
agctgtgaaacaaagcctctcagcatcaaccacagtatcaagaatccaccgatgtgtact
tgtaccaatgaagattgctacacagacagctgtgagtgtgccaacaacagtgttcaatgc
tggtatgactcggatggtcgtctctttcctgattttgactaccatgaacctcctctaatc
tttgagtgtggacctggttgtaagtgttggagatcctgtcgtaatcgtgtagttcagaat
ggcatcaggtgccaccttcagctctaccgcacggcaaaaatcggctggggtgttcgtgtc
acccaagatgtgccacagggtaccttcatttgcgagtactctggggagctgatttctgat
gcagaggctgacaaaagagaggacgattcttatctctttgatcttgataatgaggagagg
gaggtgtattgtatcgatgcccgttactatggcaacgtcagtcgtttcattaatcatcag
tgtgatcccaacatcgtgccagtgagggtgtttattgagcaccgcgatatcagctttccc
cggattgctttctttgcttcacgtgacatcaaagcacaggaggagcttggctttgactac
ggggacaaattctgggcaatcaaatccaagtttttcacctgctgctgtggatcagagcat
tgtaaacattctgaaggaacctcaggcagtgatgaaggggatccagatagctga

DBGET integrated database retrieval system