KEGG   Acanthaster planci (crown-of-thorns starfish): 110976451
Entry
110976451         CDS       T05078                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta-like
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110976451
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aplc03000]
    110976451
Transcription factors [BR:aplc03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    110976451
SSDB
Motif
Pfam: bZIP_1 bZIP_2
Other DBs
NCBI-GeneID: 110976451
NCBI-ProteinID: XP_022085410
LinkDB
Position
Unknown
AA seq 652 aa
MALDFISTPDTRFLADNLLSSEDWGDDFSHFHDNGLGSGFPDADELVRDFTTYESDPTGS
DSTGHGMLDDTTFSDYPWIKGEQQSLCTIEGIAIKSEPLSPPPSSSSSDASGDSFPPVKN
FPNPLLQVKLESPPLTPPRDNADVQHFPLANGAIKTTTVPRIAPKNPAKSTVPPIAPKGP
HQQQTGKPSATKPIPVGQPIVLTQADVARLTAQGVIKCQPPPAKQAKVASDHTVASSIPV
ATKPANNQQPPANVDLRAWKRQQRMIKNRESACLSRKKKKEYLQGLEGRMESIDQENVRL
REENGLLRKRVEELTNENNRLRKTQSLLPSSNKTTTCLLAVMLLLGFNLAPFSIFSSQGD
DYSTSRHGGRALLGYTETPPSLSQSQGSDLRQHTAYSRIEAAMHNVTDENGAPQNPLSRK
ELMVIRDMADYMLSKEQPSCPQFNVTESHRLADVLMGWAQKHQDEQRKHNQEQQIKEKKR
KIPKKKPAKRSLFRWRNPQPLFVDPDETGLQVYDSLFQRTYANLLDSLERREDTFYVVSF
RRDHTLLPATAHNNTQRPRMSLVMPSVGVNESSLNQPKDRISMMQIDCEVMNTKMVYLKE
SHIPSTQNTTVTNHTGTKPTTHGGAQRMTAPTSDSTTKFHHPKNLSARVPLS
NT seq 1959 nt   +upstreamnt  +downstreamnt
atggccctggattttatcagtacacctgacaccaggttcctcgcagacaatctcctgtcg
tcggaagactggggggatgacttctctcatttccatgacaacggtcttggcagcggcttt
ccggatgctgacgagcttgttcgtgatttcacgacatacgagtcggacccgactggcagc
gacagcaccggtcatggcatgctggatgacaccactttctccgattatccatggatcaaa
ggagaacagcaaagtttatgcaccattgaaggtattgccatcaagtcggagcctctgtct
ccgcccccgtcctcctcatcctccgatgcctccggggattctttccctcctgttaagaat
ttccccaaccccctcctccaagtcaagctggagtccccgcccctgaccccaccccgagac
aatgccgacgtccagcatttcccactggctaatggggcgatcaaaacaacgacggtgccc
cgcattgctcccaagaacccagccaagtcgaccgtccccccgatcgcacccaaggggccc
catcaacagcagacaggaaagccgtccgcgaccaagccgatacctgttggccagccgatc
gtgctgacccaggccgacgttgcccggttgactgcccagggtgtgatcaagtgccagccg
ccaccggccaagcaggccaaagtggcctccgaccacacggtggccagcagcattcccgta
gccaccaagccggccaacaatcagcagccgccggccaatgtcgatcttcgagcatggaag
aggcaacagagaatgatcaaaaacagggagtcggcgtgtttatccaggaaaaagaaaaaa
gagtacttacaaggtctggagggaaggatggaatccatcgatcaggagaacgtcagatta
cgggaggagaatggcttgctgaggaagagagtggaggaactgaccaatgagaacaatcga
ctcaggaaaacgcagtcattactaccgtcctcgaacaagacgaccacctgtctcttagcc
gtcatgctgctcctgggattcaacctggcgccattcagtattttcagctcacaaggagac
gattattcaacatcacgccacggggggcgagcactgttgggctacacagaaacccccccg
tcactcagccaatcacagggcagcgatctgcggcagcacacagcctacagccgcatcgag
gcagcaatgcataacgtaacggacgagaacggcgccccccaaaatccgcttagccggaag
gagctgatggtcatccgggacatggcagactacatgctgtccaaggagcagccgtcttgc
ccccagttcaacgtgactgaatcgcacagacttgctgatgtcttgatgggctgggcccag
aaacaccaggacgaacagaggaaacacaaccaggaacagcaaatcaaggaaaagaagagg
aaaatacctaagaagaagccagccaagcggagcctgttcaggtggaggaacccccagccg
ttgtttgtggacccagatgagacgggcctgcaagtttacgacagcctcttccagcgcacg
tacgctaatctcttggattcgctggagaggcgggaggataccttctatgttgtgtctttc
aggagggatcacacgctgttgcctgccacagcccacaacaacacccagaggccaaggatg
tccctggtcatgccctctgtaggcgtcaatgaatcctccttgaaccaacccaaggaccgc
atttccatgatgcagattgactgtgaggtcatgaacaccaagatggtgtacctgaaggag
agccacatccccagcacccagaacacgactgtcaccaaccacacagggacaaaacccacg
acccacggtggagcacagaggatgacggcacccacgtcggacagcacaacaaaatttcac
catccaaagaacctttcagcaagggtgcctctctcctga

DBGET integrated database retrieval system