KEGG   Acanthaster planci (crown-of-thorns starfish): 110977423Help
Entry
110977423         CDS       T05078                                 

Definition
(RefSeq) histone deacetylase 4-like isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aplc03036]
    110977423
Enzymes [BR:aplc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110977423
Chromosome and associated proteins [BR:aplc03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     110977423
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 110977423
NCBI-ProteinID: XP_022087235
LinkDB All DBs
Position
Unknown
AA seq 1079 aa AA seqDB search
MFLDSAMLSVAPYCDDDRPRARSMPEARTLPIIRGKMRARTLPIISESTVGGGHESVNIE
THFNSMHLKEDVASSQVPVGPGDLPTRLNPEAARQLQNELLELKQQQQWQQQVLISQFKQ
QQEQLAKQHQQQQQELIRFPLVQFAPQQQIQHDRMILAQQQQQQQQQQLEAQKQKQQHLK
QLLAKKDKPSANPSEEVKEKLHKFLLDRKQRSELAASGGASHNHSPPQAYRQWSMANRSP
HGSVDHHSPPHNISAHYQPMFGQYDSNFPLRKTASDSNLKVRSRLKEKVTERRSHGSPLP
RRRDGPGSLKRKPLTVDTSPSSSTPGSGPSSPLSAGDGANGLAAAAMPEDVNSYLLLKRM
YSSSSSDVNLYTSPSLPNISLGLPPPAGSSQHSPQMQTASKPPMNDAMRMKNPLPGGPVI
APAFIPAAQPGTIMPAGVPPPMMGGMPLHEANSMSLLGGGAVAQRLMRPIHRPLARTQSA
PLPTSQQQILMQQHQQHQQFLHQQQQQLMALQQRQQEDAVAEKEAEEAEHKQVQSLPLKN
ITEIKQEPIDIEEEDEEEEERLQLQQEQEELMRQQSLGCLRLTGTDTLPGNRPSSSGHRP
LSRAQSSPAAASRPGMLGAGTDHHHHLHHHHHHHNLPHHHHQIKHLFTTGLAYDTLMLKH
QCTCGNNAAHPEHPGRLQSIWARLQETGIANQCERIRTRKATLEELQSCHSEGYVLFYGT
SQPNRPKLDSKKLACIPKLNFTWLPCGGLGVDNDTVWNDLHSPSAARIASGSVIELAFKV
AAGELKNGFAVVRPPGHHAETSQAMGFCFFNSVAVAAKQLRLKLKLNKILIIDWDVHHGN
STQKIFYEDPHVLYISLHRHDEGNFFPGTGAPDECGCGAGLGYNVNIAFHGNLDPPMGDT
EYLAAFRSVVLPIAREFSPDVVLVSAGFDAAEGHANPLGGYQVTPACFGYMTKQLMTLAG
GRVVLALEGGYDLPAICDSSEVCAQVLLGDEGPQLSERAMTSIPNEKAVECLQRAIQVQS
EYWTSVRAMGPLVTCSAQESNQLLQREKDEAETVTAMALLSVRQKARSEPMEEDYKDES
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagattctgcaatgttgtccgtcgctccgtactgtgacgatgacaggccgagg
gcgcggtctatgcccgaggcgagaacgctgcccatcattagggggaaaatgagagcaaga
acattgcccatcatcagcgaatctaccgttggaggaggccacgaaagcgtgaacattgag
acccacttcaacagtatgcacctgaaagaagatgtggccagcagccaggtgcccgttggt
cctggtgacctgccgacccggctcaaccccgaggcggcccgccagctgcagaatgagcta
ctggagctcaagcagcagcagcagtggcagcagcaggtcctcatcagtcagttcaagcag
caacaggagcagctggccaagcagcatcaacagcagcagcaagagctgatccggtttccc
cttgtccaatttgcaccacagcagcaaatccagcacgaccgcatgatcctggcgcagcag
cagcaacagcagcagcagcagcagttggaggcgcagaagcagaaacagcagcacctgaaa
cagctgctggccaagaaggacaagcccagtgcaaacccttccgaggaggtgaaggagaag
ctgcacaagttcctattggaccgcaagcagcgcagcgagctggcggccagcgggggggcc
agccacaaccactccccgccccaggcctaccgccagtggtccatggccaaccgcagcccc
cacggctccgtggaccaccactccccgccccacaacatctccgcccactaccagcccatg
tttggccagtacgacagtaacttcccgctacgaaagactgcctcggactccaacctgaag
gtgcgctctcgcctgaaggagaaagtgacagagaggcggagtcacggcagccccctccca
cgaagacgagacgggcccggaagcctcaagaggaagccattaacagtggacacctcaccc
tcaagtagtactcccggatcgggtcccagctctcccctcagtgcaggagatggagctaac
ggattggctgcggctgccatgccggaggacgtgaacagctacctgttgctgaagcgcatg
tacagtagcagcagcagcgatgtcaacctctacacctcaccgtccctgcccaacatctcc
ctgggcctgccgccgcctgctggctcctcccagcactcaccgcagatgcaaactgcgagc
aagccaccgatgaacgacgcgatgcgtatgaagaaccccctacccgggggaccggtcata
gcccctgccttcatacctgctgcgcagccaggaaccatcatgcccgccggtgtgccccca
cccatgatgggcggcatgcccctccacgaggccaactccatgagcctgttgggaggcggt
gccgtcgcacagagactaatgagacctatccacaggcccctggccaggacccagtccgcc
cccttgcccaccagccagcagcagattctcatgcagcagcaccagcagcaccagcagttc
ttgcaccaacagcagcagcagctgatggcgctgcagcaacgacagcaggaagatgcagtc
gctgagaaggaggcagaggaggcagagcacaagcaggtgcagagcctgccgctgaagaac
atcacagagatcaagcaggagcccatcgacattgaggaagaggacgaggaagaggaggaa
cgcttgcagctccaacaggagcaagaggagctgatgcgtcaacaatcactgggatgcctc
cgcttgactggaacagacacgttaccgggtaaccggcccagtagtagcgggcatcgcccc
ctttcccgagcccagagctcccccgccgcggccagccgtccgggcatgctcggagccggc
acggatcaccaccaccatctacaccaccaccatcatcaccacaacctcccccaccatcac
caccaaatcaaacatttgttcaccacaggtcttgcctacgatacactgatgctgaagcat
cagtgtacgtgtggtaacaacgccgcacatcctgagcatccgggccggttacagagcatc
tgggcgcgtcttcaggagacgggcatcgccaaccaatgcgagcgcatccggaccagaaaa
gctaccttagaagagctacagtcttgccatagtgaggggtacgttttattctacggaacc
agccaaccgaacagacccaagctagacagcaagaaattagcctgtattcctaaactgaac
ttcacctggttgccctgcggcggtctgggggtggacaacgacaccgtctggaatgactta
cactccccaagtgctgccagaatcgcctctggttccgtcatcgagctggccttcaaagtg
gccgctggtgagctgaaaaacggctttgccgtggtgcggccgccgggccaccacgccgag
acctcccaggccatgggcttctgcttcttcaactcggtggccgtggccgccaagcagctg
cgcctcaaactcaagctcaacaagatccttatcattgattgggatgttcaccatggcaac
tccacccagaagatcttctatgaggatccccacgttctttacatctccctgcatcgtcac
gacgagggcaacttctttcctggcactggtgcacctgatgagtgcggatgcggtgctggt
cttggctacaatgtcaacattgccttccacggcaacctggacccaccgatgggcgacacg
gaatacttggctgccttcaggtctgtggtgctgcccattgcacgggagttctcccccgac
gtggtcttggtctctgctggttttgatgccgctgagggacacgccaatcccctcggaggc
taccaagtcacccccgcttgttttggctacatgaccaagcagctgatgaccctggccggg
ggtcgcgtggtcctggccttggaaggcggctatgacctgccagccatctgcgactcctcc
gaggtctgcgcgcaggtgctgctcggggatgagggcccacagctgagcgagcgcgccatg
acgtcgatccccaacgagaaagcagtggagtgtctgcagcgtgctatccaagtccaatcc
gagtactggaccagtgtgcgagccatgggccccctggtcacatgttcagcccaggaatcc
aaccagctcctccaacgagagaaggacgaagcagagactgtcactgccatggctctactc
tcagtcagacaaaaagctaggtcagaaccaatggaggaagattataaagacgagtcatag

DBGET integrated database retrieval system