KEGG   Acanthaster planci (crown-of-thorns starfish): 110980113Help
Entry
110980113         CDS       T05078                                 

Definition
(RefSeq) pyrimidodiazepine synthase-like isoform X1
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00480  Glutathione metabolism
aplc00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110980113
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    110980113
Enzymes [BR:aplc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     110980113
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3 GST_N_4 Glutaredoxin DctA-YdbH
Motif
Other DBs
NCBI-GeneID: 110980113
NCBI-ProteinID: XP_022092154
LinkDB All DBs
Position
Unknown
AA seq 231 aa AA seqDB search
MSVKHLEAGQPLPPLKDGSIRLFSMKYCPFAQRSRLVLKIKGIDFEEINCNLTKKPEFLL
ERNPDGKVPVYEHNGEVLIESTVICDYLDEIYPDPPLYPKDPLQKAKDKIVVAAYGSKVI
PAFYKCLRSGAEDDEANLIAGLTLYDAELKKRGTPFFGGQQPSMVDYVTWPWNERLMVFD
KLMNTLKAKLPDLDAYFQRMLTTPMIQAFNDREYYKTFYEGYAHGDPQYDF
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtaaaacaccttgaagcaggtcaacctctacctcccctcaaagatggatccatt
cgtctcttcagcatgaaatactgcccgtttgcacagcgctctcgcttggttcttaaaatc
aaaggaatcgactttgaggagattaactgcaacctgacgaaaaagccagaattcctcctt
gaacgaaatcctgatggaaaagtgcctgtctacgaacacaatggcgaagttctgattgaa
tccaccgtcatctgtgactacctagatgagatttatcctgatccacctctctaccccaaa
gatccattgcagaaggctaaagataaaattgtcgtggcagcttatggatcaaaggttatc
ccagccttttataagtgcttacggtctggtgcagaagacgatgaagcaaatctcattgct
ggcttgacgttgtatgatgcagaactaaagaaaagaggaaccccattctttggtggtcaa
cagcccagcatggttgactacgtcacttggccttggaatgagcgtttaatggtctttgac
aagctcatgaacaccctgaaagccaagctaccagaccttgacgcttacttccagcggatg
ttaaccacaccaatgattcaggctttcaacgacagagagtactataagacattctatgag
ggctatgcccatggggatcctcagtatgacttctaa

DBGET integrated database retrieval system