KEGG   Acanthaster planci (crown-of-thorns starfish): 110980139Help
Entry
110980139         CDS       T05078                                 

Definition
(RefSeq) pyrimidodiazepine synthase-like
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C_3 GST_C Glutaredoxin GST_N_4 DUF3600
Motif
Other DBs
NCBI-GeneID: 110980139
NCBI-ProteinID: XP_022092206
LinkDB All DBs
Position
Unknown
AA seq 234 aa AA seqDB search
MSEKHLEAGQPLPPLKDGSVRLFSMKYCPFAQRSRLVLKAKGINYEEINCNLKKKPEFLL
ERHPDGKVPVFEHNGKVLIESSIICDYLDEIYPDPPLYPKDPFQKAKDKVVMETYASKVI
PAFYKAMGSGGQDNETATNLIAGLTLFDAELKKRGTPFFGGQQPSMVDYITWPWNERLMV
SDKLMNTLKAKLPDLDAYFQRMLTTPAVKAILNSKEQYQKYHESSISGNPQYDL
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaaaacaccttgaagcaggtcaacctctaccacccctgaaggatggatctgtt
cgtctcttcagcatgaaatactgtccttttgcacagcgctctcgcttggtgctgaaggcc
aaaggaatcaattatgaagaaattaactgcaacttgaaaaaaaagccagaattcctcctt
gaacgccaccccgatgggaaagtccctgtctttgaacacaatggcaaagtcctgattgaa
tccagcatcatctgtgactacctagatgagatttatcctgatccacctctctacccaaag
gatccatttcagaaggctaaagataaagtcgtcatggaaacctatgcttcaaaggttatc
ccagccttttacaaagccatggggtctggtggacaggataatgaaacggctactaatctc
attgctggcctgaccttatttgatgcagaactaaagaaaagaggaaccccattctttggt
ggtcaacagcccagcatggtcgactacatcacttggccttggaatgagcgtttaatggtc
tctgacaagctcatgaacaccctaaaagccaagctaccagaccttgatgcttacttccag
cgaatgttaactacaccagcagttaaggctatcctcaacagtaaagagcagtaccaaaag
taccatgagagctctatcagtggtaatccccagtatgacctgtga

DBGET integrated database retrieval system