KEGG   Acanthaster planci (crown-of-thorns starfish): 110981575Help
Entry
110981575         CDS       T05078                                 

Definition
(RefSeq) procollagen galactosyltransferase 2-like isoform X1
  KO
K11703  collagen beta-1,O-galactosyltransferase [EC:2.4.1.50]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00310  Lysine degradation
aplc00514  Other types of O-glycan biosynthesis
aplc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    110981575
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    110981575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:aplc01003]
    110981575
Enzymes [BR:aplc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.50  procollagen galactosyltransferase
     110981575
Glycosyltransferases [BR:aplc01003]
 O-Glycan biosynthesis
  O-linked Gal type
   110981575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_25 Glyco_tranf_2_4 Anp1
Motif
Other DBs
NCBI-GeneID: 110981575
NCBI-ProteinID: XP_022094922
LinkDB All DBs
Position
Unknown
AA seq 688 aa AA seqDB search
MTEDQPIGLALAVAHHAHHVRRPILGLLRTSSTSDSTSRPRPVTEKVEVLQPTVFIPILA
RNKEHTLPTFLGCLENLQYPKDRISLWIRTDHNIDNTATLLQEWVNKSGSLYHRVDIDVQ
NEPQAFDWENGPSDWPDERYLHVITLRQRALEEARFQWADYLLAVDVDNFLENPRVLLDL
MTQEKTVIAPMLVSTKMYSNFWGGTNQKGYYRRTEQYVHILKRNFTGVFEVPMVHSTYLI
NLRHKISVQLSYNPLPGFTGDIDDMMTFAFSAKKAGIPFHVTNRNYYGSLLIPLSAKKPL
EYEKEQMLHLRLEAMVDNAGLPLSKHVSVPARQQSKLGFDEIYMINLKRRPERRLRMVAA
LKDLGIAFKIVDAVDGKALTDQDLEDLGVDMLPGYRDPYYERVLTRGEIGCFLSHYFIWQ
DVVRNNYKKILIFEDDVRFKESFRPKMEELLQEIAQKNLDWELLYIGRKIMERDYENYVD
GFMHVVKPSYTYWTLSYMLTFDGAQKLLSQEPLGKMIPVDEYIPIMFDVHPENDWAHAFH
PRDLKAYSVNPLLVEPTHYTGEEKYISDTETKDIWEYVLQREGTSDKAGFSKQQKDASDD
PKSSKGRLDLMEQHEDDKHTGNKVWNDGQRMHGHGTMPSADDSLNGTHAVELTANKKLDS
QDSSAESSNPDAERDRAASEDINTHTEL
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgacggaggaccaaccgataggcctagcgctagcagtagcacatcatgctcaccatgtt
cgcagacccatactaggcctactacgtactagtagtactagcgatagtactagtaggccg
aggcctgttacagagaaggttgaggtattgcaaccaacagttttcattcctatcctggca
agaaacaaggaacacactttacctacatttcttggatgtttagagaacctgcagtatcca
aaggatcgcatatccttgtggattcggacagaccacaacattgataacactgctactttg
ctacaagaatgggtgaacaaaagtggatctttataccaccgtgtagatattgatgtacaa
aatgaacctcaagcttttgattgggaaaatggtccaagtgattggcctgatgaaagatac
ttgcatgtgattactctgagacagagggctttagaggaagcaagatttcagtgggctgat
tacctactagcagttgacgttgataactttctggaaaatccaagggtattacttgatctg
atgacacaagagaaaacagtcattgctccaatgctggtatcgacaaaaatgtattcgaac
ttctggggaggaacgaaccaaaaggggtactacagaaggacggaacagtacgttcacata
ttgaagagaaatttcactggtgtatttgaagtgcccatggtacattctacgtatctcatt
aatctgcgtcataaaatctcggtccagttgtcttataatcctcttcctggctttactggt
gatattgatgacatgatgacttttgccttctctgctaaaaaagcaggtattcctttccat
gtgacaaaccgcaattattatggaagcctcctaattccattaagtgctaagaagccatta
gagtatgagaaagagcaaatgctgcatctgcgacttgaagctatggttgataatgcaggc
ttgcctttatcaaaacatgtatcagtgccagcaaggcaacaaagcaagttaggatttgat
gaaatctacatgattaatctgaagagacgtcctgagagacggctgagaatggtagcagct
ttgaaagacttaggaatagccttcaaaatagtggatgctgttgatggaaaagcattgacg
gatcaggacctggaagatttaggagttgatatgttacctggttacagagacccctactat
gaacgtgttttgaccagaggagagattggctgcttccttagccattacttcatatggcaa
gatgtggtgagaaataactacaaaaaaatcttgatatttgaggatgatgtgagattcaaa
gagtcatttagaccaaagatggaagaattgctacaagaaatcgcacagaaaaatctggac
tgggagctactctacattggtcgcaaaataatggaaagggactatgagaattatgttgat
ggtttcatgcacgtcgtcaaaccaagctacacatactggactctgagctacatgcttact
tttgatggagcccaaaagctgttatcacaagagcccctgggaaagatgataccagttgat
gagtacataccaatcatgtttgatgtacatccagagaatgactgggctcatgcatttcat
ccgcgtgacctcaaagcatattcggtcaacccacttcttgtggaaccaacacactacact
ggggaagagaaatacatcagtgatacagaaacaaaggacatttgggagtatgttttgcaa
agagaaggaacttcagataaagctggttttagtaagcagcaaaaggatgccagtgatgac
ccaaaatcaagcaaaggaagactagatttaatggaacaacatgaagatgacaagcacaca
ggaaacaaggtgtggaatgatggacaaaggatgcatggacatggtacaatgccgagtgct
gatgacagtttaaatggcactcatgctgtagaactcactgcaaataagaaactagattct
caagatagttcagctgagtcatctaatcctgatgctgaaagggacagagctgcttctgag
gacataaatactcacactgagttatga

DBGET integrated database retrieval system