KEGG   Acanthaster planci (crown-of-thorns starfish): 110981743
Entry
110981743         CDS       T05078                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog B-like
  KO
K20017  Bcl-2 family protein
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 110981743
NCBI-ProteinID: XP_022095254
LinkDB
Position
Unknown
AA seq 267 aa
MTGGKKLSKTRRISRSSMSASFLLKERWKTSSERMLAAVEMVSSFLNEQAIKAATFIGLG
KLFDSPYTEEMVVQQTRVLCRDYIFTKLRENSLLKHDIYPPGLEVDDVVRACQPKGHDMT
CGACDVSRELVTITQEFDRMYPYLFKDICTYLHVNFQTGAQLQTVFTAVAAELFRRSITW
ARVVALFAFTGALVVECVEQGHVNYANIVVDSMQKFTRRRLAAWVVKQGGWPAMVHHVQS
YRVSSSRLWFLSIIGAAVGITLTLGLP
NT seq 804 nt   +upstreamnt  +downstreamnt
atgacaggtggcaagaaactatcaaagactcgtcggataagtcgcagtagtatgtctgcc
tccttcttgctcaaggagcgctggaagacatcatcagagcgaatgttggcagctgttgag
atggtttcatccttcttgaatgagcaagccatcaaagctgccactttcattggtttgggc
aagctatttgacagcccgtataccgaggagatggttgttcagcagacgcgggtcctgtgc
cgcgattacatcttcaccaagctgcgtgagaactccctcctcaagcacgacatctatccg
ccaggcctggaggttgatgacgttgtgcgcgcctgtcagccgaaagggcacgacatgacg
tgcggggcgtgcgacgtctcccgcgaactcgtgaccatcacgcaggagtttgaccgaatg
tacccatatctcttcaaagacatctgcacgtaccttcatgtcaactttcaaaccggggcc
cagctgcagacagtctttacagccgtggccgccgagctcttccgacgctccatcacctgg
gcacgcgtggtggcgctctttgcatttaccggcgccttagttgtggaatgcgtggagcag
ggtcacgtgaactatgccaacatcgttgtagattctatgcaaaagttcaccaggagacgc
ttggctgcttgggttgttaaacaaggaggctggcccgccatggttcatcatgtccagagc
taccgagtctcatcctctcgtctttggttcctgtctatcatcggtgcagccgttggcatc
accctcacgctgggcctcccctag

DBGET integrated database retrieval system