KEGG   Acanthaster planci (crown-of-thorns starfish): 110981878Help
Entry
110981878         CDS       T05078                                 

Definition
(RefSeq) DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc03030  DNA replication
aplc03410  Base excision repair
aplc03420  Nucleotide excision repair
aplc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    110981878
   03410 Base excision repair
    110981878
   03420 Nucleotide excision repair
    110981878
   03430 Mismatch repair
    110981878
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aplc03032]
    110981878
   03400 DNA repair and recombination proteins [BR:aplc03400]
    110981878
Enzymes [BR:aplc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110981878
    6.5.1.6  DNA ligase (ATP or NAD+)
     110981878
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     110981878
DNA replication proteins [BR:aplc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    110981878
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     110981878
DNA repair and recombination proteins [BR:aplc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     110981878
   NER (nucleotide excision repair)
    Other NER factors
     110981878
   MMR (mismatch excision repair)
    Other MMR factors
     110981878
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 110981878
NCBI-ProteinID: XP_022095560
LinkDB All DBs
Position
Unknown
AA seq 1052 aa AA seqDB search
MNGLLLIGGRRFLYEACKRRLFDRFEGLQSHPVFHCRQRNLIKTEANLLRRPSFHLTMAQ
RSIMSFFSPKRHMGTTDKVASSGNIQDDRSPLKVKNSTNQESPVEQTRKKFRRILDSDEE
DSNENVSRTTPTKTAPVESPPMEDTPKRKAATADELASDPIPPSPVTPSQALETASPSST
PGSIPLRKTARKHMRKRKAEEQKGEEQDIATPIKAESESKKIKTDKLLTPETTSEEATKS
TTEVDSPVTKVKEEMMDGVEEPPEAKEDMQDGKNGKAKPRDTKKEKKSPKAKNSETREKK
AETKKAKTPPKKDSKREVLKPSIKNESKGAEESKASGNKTEKMTSPKVKEEVASPAGSKT
SSVTEEERDKGEKPKDGKTPAKNVFGMFSKVAASDSVEYNPGAPRYHPVKDACWKQGERV
PYLALAKTFDIIEATSGRLKTIETLTDFLTSVLVLSPKDMEMCVYLCLNKIAPAYEGIEL
GIGETILMKAIAQSTGRTVEKVKADAAQQGDLGLVAQSSRSNQRTMFTPARLTVLKVFNT
LKEIATMSGNASMSRKIEKIKSLLVACRDCESKYIIRSLGGKLRIGLAEQSVLVAIGHAA
VISPPGIAVDSVLSKSKVSDALKKKMDDAALIIKTTYCELPNYGAIIPALLEHGYENLPE
HCKLTPGIPLKPMLAHPTKGVSEVLNRFQNMAFTCEYKYDGERAQIHLLGNRKIHIYSRN
QENNTSKYPDIIKRLPSAYDPEKVKTCVLDAEAVAWDRENQQILPFQVLSTRKRKDAAEA
EIKVQVCLFVFDLLFLNEESLVTKTLRKRRELLNSHFTPVEGEFMFAKSMVSTDTEDIAS
FLDESIKGNCEGLMVKTLDEDATYEIARRSHNWLKLKKDYLEGVGDTLDLVVIGGYHGRG
KRAGTYGGFLLACYDDENEEFQTICKIGTGLKDEELDTHSKFFKAHVIDKPRPYYRHDTS
HTPDHWFDAVQVWEVKAADLSVSPTHRAAIGIVDPEKGISLRFPRFLRVRDDKKPEEATN
SSQVASLYNNQDQIKNQKATGVLKPKASEDFY
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtttgctactcatcggtggtagacgatttttgtacgaagcttgtaagcggcga
cttttcgatagatttgaagggctccagtcacatcctgtgtttcattgcagacaacgaaat
ctgatcaaaactgaagcaaatttgttgcggagaccttccttccacttaaccatggcgcag
cgatcgataatgtcatttttcagtcccaagcggcatatgggaacaacagacaaagtggca
tcatctggaaacatacaggatgatagatctccactgaaagtaaagaatagtacaaaccaa
gagtcgccagtcgagcaaacacggaagaaatttcggcgcatccttgatagtgacgaagag
gatagcaatgagaatgtgagcaggaccacacccaccaagaccgcacccgtggagagccca
cccatggaagacacacccaagaggaaggctgccacagctgacgaattggcctctgacccc
atcccaccatcgcccgttaccccatctcaagcactggaaacagcttcaccatcatctaca
ccaggcagcatacctctcagaaagactgcacggaaacatatgagaaagaggaaagcggag
gaacagaagggggaggaacaggatattgccacacccatcaaggcagaatcagaatctaag
aagatcaaaacagacaagctattgaccccagaaaccacctcggaagaagcaactaaaagc
actaccgaggtggactcgcctgtgacaaaagtcaaagaagaaatgatggatggcgtggag
gaacctccagaagcaaaggaggatatgcaggatggcaaaaacggaaaagccaaacccaga
gatactaagaaggaaaagaagtcccctaaagccaagaattctgaaactagagaaaagaaa
gccgagaccaaaaaggccaaaacgccaccgaagaaagactccaagcgggaggtgctgaaa
ccgtcaataaaaaatgaaagcaaaggagcagaagaatcaaaggcttcaggtaacaagaca
gagaaaatgacgtcacccaaagtgaaagaagaagtagcgtcaccagctggcagcaagaca
tcgagtgtgacagaggaggaaagagacaaaggggagaaaccaaaggatggcaagactcca
gccaagaacgtatttggaatgttttccaaggtggctgcgtcggacagtgtggagtacaac
cctggagccccccggtaccatccagttaaagatgcctgctggaagcaaggagaaagggtt
ccatacttggccttagctaagacctttgacattatagaggccacctcgggccggttgaag
accatcgaaaccttgactgactttctgacatctgtcttggtgctgagtcccaaggacatg
gagatgtgtgtgtacttgtgcctgaataagattgcaccggcatacgagggaatagagctt
ggcatcggagagacaatactaatgaaagctatcgcgcaaagcacagggcgcacagtggag
aaagtaaaagctgatgctgcacaacagggtgacttgggactcgttgcacagagcagccgc
agcaaccagcgtacgatgttcaccccagccaggctgacagtgctgaaggtcttcaataca
ttgaaagaaatagccacaatgtcaggcaatgcttccatgtctaggaagattgagaagatt
aagagtcttctagttgcctgcagggattgtgagtccaagtacatcatcagatctttaggt
gggaaactacgcatcggtcttgccgaacagtcagttctcgttgccattggtcatgcagcc
gtcatttctccccctggaatagctgtggatagtgttttatcaaagagcaaagtatctgac
gctttgaagaagaagatggacgatgcagcactgatcatcaagacaacctattgtgaactt
ccaaactatggggctatcatcccggccttgcttgagcacggttatgaaaacctacccgag
cactgcaagctgacccctggcatccccctcaagcccatgctggcgcaccccaccaagggg
gtgtcggaggtcctgaatcgcttccaaaatatggccttcacctgcgagtacaagtacgat
ggggagagggcacagatccaccttcttggcaacaggaagatacacatctacagtcgaaat
caggagaataacacctctaaatacccggatattatcaagcgcttgcccagtgcctatgat
cccgaaaaggtgaagacttgtgttctggatgcagaagccgtggcatgggatcgtgagaat
cagcagatcctgccgttccaagtcttgagtaccagaaagcgaaaggatgcagcggaagca
gagatcaaggtccaggtctgcctcttcgtctttgatctgctctttctcaatgaggagtct
cttgtgacaaagacacttcgcaagaggcgggagctactcaactctcacttcaccccagtt
gagggagagttcatgtttgccaagtccatggtttccacggatacagaagacattgcttcc
ttccttgatgagtccatcaaaggaaactgcgaaggtttgatggtgaaaacattggacgag
gatgctacctatgaaattgctcgccgctcacacaactggttgaaattaaagaaggactac
ctagaaggtgttggggacactctcgaccttgttgtcatcggtggctaccatgggcggggc
aaaagggcgggaacatatgggggcttcctgttggcctgttacgacgatgagaatgaagag
ttccagacaatctgtaagattggcactggtctcaaagacgaggagttggacacccacagc
aagttcttcaaggcccatgtcatagacaagccccgcccgtactaccgtcacgacacaagc
cacaccccagaccactggtttgatgctgttcaggtgtgggaggtcaaagcggctgatctc
tccgtctctccaactcaccgggcagccatcggcattgtcgaccctgagaaaggtatctcc
ctgcgatttcctcgcttcctgcgagtgcgagatgacaagaagccagaagaagccaccaac
agttcacaggttgcaagtctctacaacaaccaagatcagattaagaaccagaaggcaaca
ggtgttctcaaacctaaggccagcgaagacttctattga

DBGET integrated database retrieval system