KEGG   Acanthaster planci (crown-of-thorns starfish): 110983098Help
Entry
110983098         CDS       T05078                                 

Definition
(RefSeq) hexokinase-2-like isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00010  Glycolysis / Gluconeogenesis
aplc00051  Fructose and mannose metabolism
aplc00052  Galactose metabolism
aplc00500  Starch and sucrose metabolism
aplc00520  Amino sugar and nucleotide sugar metabolism
aplc01100  Metabolic pathways
aplc01200  Carbon metabolism
Module
aplc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aplc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110983098
   00051 Fructose and mannose metabolism
    110983098
   00052 Galactose metabolism
    110983098
   00500 Starch and sucrose metabolism
    110983098
   00520 Amino sugar and nucleotide sugar metabolism
    110983098
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    110983098
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aplc04131]
    110983098
Enzymes [BR:aplc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     110983098
Membrane trafficking [BR:aplc04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    110983098
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 110983098
NCBI-ProteinID: XP_022097738
LinkDB All DBs
Position
Unknown
AA seq 476 aa AA seqDB search
MASSGTPKWVNVGGRWIRATPASNISEKTVSTKSTKNEVDEILQKLALSNAHLEEITSLM
RQNMDRGLDSATHQSAIVKMFPSFVRSLPDGSEKGDFFALDLGGSNFRVLRVQLLEGDVQ
MTSKVYKIAEETMTGTGDQLFDYIADCLSEFKKEEGLGDVDLPLGFTFSFPCKQNGLASA
ELVQWTKGFSASGVVGKDVVQLLKEACVRKNVNLHIVALVNDTVGTLMSCAYSRSDAYIG
LILGTGTNACYLEKLSNVGTWTGDSGEPTNVIINMEWGAFGSDGALDNFRTEFDKQVDEV
TPNKGKQLYEKMISGMYLGEIVRLILVKLTTDGHLFGGKVSPDLNTPWKFETRFLTDIES
DTSSDNGECRTILTSLGVTPSVSDLATVRRICEAVSTRAARLAVAGLSAVIRKMGAGELT
IAVDGSLYKKHPTFKSNMEATLQELVPGVTIKLMLSEDGSGKGAALVAAVAARISS
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggctagctcaggtactccaaaatgggtcaacgttggcggtcgctggataagggcaaca
cccgcgtccaacatttctgaaaagacagtgtccacaaaatcaactaagaatgaggttgat
gagattttgcagaaattagctctgtccaatgcacatttggaggagatcaccagcctcatg
cggcagaacatggacagggggctggatagtgctacccaccagtcagctatcgtcaagatg
ttccctagctttgtacgatctctaccagatggatcagagaaaggtgatttctttgcactg
gaccttggaggcagtaatttcagagttcttcgagtccagctactggaaggtgatgtccaa
atgacgagcaaggtttacaagattgctgaggagactatgacaggaacaggggatcagttg
tttgactacattgccgactgcctgtctgaattcaagaaggaggaggggctcggtgatgta
gatcttcccctcgggtttaccttctccttcccctgcaaacagaatggactagcttcagct
gaactggtgcaatggaccaaaggcttctcagcctcaggagtggtagggaaagacgtggtg
caattactcaaagaggcctgtgtaagaaagaatgtaaaccttcatatcgtagcattagtc
aatgacactgtgggaacactgatgtcgtgtgcctactcccgtagcgacgcctacattgga
ctcatccttgggacgggaactaacgcctgttacctggaaaagctgagcaacgtgggcacg
tggaccggggacagcggggagccgactaacgtcatcatcaacatggagtggggagcgttt
ggcagcgacggggcactggacaatttccggaccgagtttgacaaacaggtggatgaagtg
acccccaataaaggcaaacagctttacgagaagatgatttccggcatgtacctgggcgag
atagtcaggctgattctggtgaagctgacgactgatgggcacctgtttggtgggaaagtc
tcgcccgatctcaacactccgtggaaatttgaaacccgtttcctgacagacatagaaagt
gacacatccagtgacaacggagagtgcaggaccatcctgaccagcctgggcgtgaccccc
tctgtctctgacctggccactgtccgccgcatctgcgaggccgtctccacccgcgcagcc
cggctggccgtggccggcctgagcgcagtcatccggaagatgggggctggggagctgact
atcgcagtggacggctcactctacaagaagcacccgaccttcaagagcaacatggaggcc
accctgcaggagctggtgccaggcgtcaccatcaagttgatgctgtcggaagacgggagc
gggaagggcgcggcccttgtggctgcagtggcggcaaggatcagctcttag

DBGET integrated database retrieval system