KEGG   Acanthaster planci (crown-of-thorns starfish): 110984215
Entry
110984215         CDS       T05078                                 

Definition
(RefSeq) TGF-beta receptor type-2-like isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc04068  FoxO signaling pathway
aplc04144  Endocytosis
aplc04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110984215
   04068 FoxO signaling pathway
    110984215
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110984215
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aplc01001]
    110984215
Enzymes [BR:aplc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110984215
Protein kinases [BR:aplc01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   110984215
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ecTbetaR2 APH
Other DBs
NCBI-GeneID: 110984215
NCBI-ProteinID: XP_022099851
LinkDB
Position
Unknown
AA seq 601 aa
MGFTYPVSLSRACTPQPRGRVFPIFAAFVIVCAWFDVSTNAASYCFSCNETVLDCDMDRL
VCRSRCDEKVACQSSNSYCLIATYTAGSDVQEFASVTCFENQPLSESDVTPHYCGAPDTD
YSTDDSYWFIYTCTCTHDYCNDAIYLPGAEVPKPTPHPPTTEQGTPSKEGPNPVTTPKDD
NVSNDEDSDGGMKTLTIVLASSLPVVIVAVLGVSGFYIYRYCQKLKQDRKPHPPTSNTES
TSLDLTTEDSDVKVIGQDTPPESPVHLRGNYLPISLSTVIGRGRFGAVWKADLKEGDGPA
DETVVAVKIFHEIDSASWSVEKEMFTDETVMLKHDNVVEFIAAEVRQGSYDSQRQFWLVT
RYYSKGSLYQYLKHHTVGWQELCRLAGTTARGVAHLHAEVYGPHGLHKVPVAHRDLKSSN
VLVKDDGTCAIADFGLSIQLDPTLSIDQLANSGQAGTPRYMAPEALESKVNLHDIESFKQ
MDVYSLSLIVWEIAKRCHIGDVVSAAPEHQLPFFDSVAGRANIEDMKTVVALQRERPTIP
PSWSENTGMQLVSATMEDCWDSDPEARLTAHCVEARFTEIITWTEGEQNPGHNDINTITV
V
NT seq 1806 nt   +upstreamnt  +downstreamnt
atgggttttacgtacccggtgtcattgtcgagggcatgcacgccacaaccacgtggccgt
gttttcccgatcttcgctgcatttgtgattgtctgtgcttggttcgacgtttccaccaac
gcagccagttactgcttcagctgcaatgagaccgtcttggactgcgacatggatcgcctg
gtctgccgaagccggtgcgacgagaaggttgcttgccaaagcagcaattcgtattgcctg
atagccacgtacactgccggaagcgacgttcaggagtttgcctccgtaacatgcttcgag
aaccaaccgctgagtgagagtgacgtcacccctcattactgtggtgcgccggacaccgat
tactccaccgacgattcgtactggtttatatacacctgcacgtgcacgcacgactactgc
aacgacgccatctaccttcccggggcggaagtgccgaaaccgacgccgcatccaccaacc
actgagcaagggacaccatccaaagaaggcccaaatcctgtgacaacaccaaaggatgac
aatgtgtcaaatgatgaagactcagacggagggatgaaaaccctgaccatcgtgttggcg
tcaagccttccagtagtgatagtcgctgtgcttggggtcagtgggttctacatctaccga
tactgccaaaaactgaagcaggaccgcaagccgcaccctcccacaagtaacacagagagc
accagcctggacctgacgactgaggatagtgatgtcaaggtcataggccaagacacaccg
cctgagagtcctgtgcacctgcgcggcaattatctgcccatctctctgagcacggtgatt
gggagaggacgcttcggcgcggtctggaaggcggacctgaaggagggcgacggccccgcc
gacgagacggtcgtggctgtcaagatcttccacgagatcgactcagcctcctggagcgtg
gagaaggagatgttcactgacgagacggtcatgctcaagcacgacaacgtggtggagttc
atcgcggccgaagttcggcagggcagctatgactcccaacgccagttctggttggtcacc
aggtactactctaagggctcactgtaccagtacctgaagcatcacactgttggctggcag
gaattgtgccggctggcgggcacgacggcccgcggggtcgcacatcttcacgccgaggta
tacgggccgcatggcctccacaaggtccccgtggctcaccgggacctgaagagctccaac
gtgctggtgaaagatgacgggacgtgcgccatagcagacttcggattgtctatacaacta
gacccgacgctgtctattgaccaattggcaaatagcggtcaggcgggaaccccccgctac
atggcccctgaagccttggagagcaaagtcaaccttcacgacatcgagtcctttaaacag
atggacgtgtactctctcagtctcatcgtttgggagatagcaaaacgatgccacattggc
gacgtggtgtcagcagcaccggagcaccagctcccattttttgacagcgtcgccggtagg
gcgaacatcgaggacatgaagacggtagttgcactgcagagagaacggcccaccatccca
ccttcgtggagtgaaaatacggggatgcagcttgtatcggctaccatggaggactgctgg
gatagcgacccagaggctcggctcacagcgcactgcgtggaggcccgtttcacggaaatc
atcacctggactgagggcgaacagaacccggggcacaatgatattaacactattactgtg
gtttga

DBGET integrated database retrieval system