KEGG   Acanthaster planci (crown-of-thorns starfish): 110985759Help
Entry
110985759         CDS       T05078                                 

Definition
(RefSeq) insulin receptor substrate 1-B-like isoform X1
  KO
K16172  insulin receptor substrate 1
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc04068  FoxO signaling pathway
aplc04140  Autophagy - animal
aplc04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110985759
   04150 mTOR signaling pathway
    110985759
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110985759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRS PH
Motif
Other DBs
NCBI-GeneID: 110985759
NCBI-ProteinID: XP_022102733
LinkDB All DBs
Position
Unknown
AA seq 1054 aa AA seqDB search
MSSQKENIPGAGDGSDIVKCGYLKKFKTMRKKFFVLRCESSSCPARLEYYDSEKKFRAGA
LCKRTIDLKTCFNINRKTDSKHRHAIALYTRDDCFVVVAEDENSLNEWLQELLLQQQAEN
DGMPMPAFEHVWQVTVKPKGLGSSKGLSGNYRLCLTATTVNLVKMNCENEDLEFPLSAIR
RCGHSDCFFFMEVGRQSVTGTGEIWMQVEDTVIAQNIHEASLNAMRSISQQEEEMRPRSQ
SSGNTSEAKPGSSRRQVATLGPSWRTRCESMPAQNRPRMGRSRLGSESEESLQEEPSPTS
APSGSALTSSVIRPRTQSEGEGNHTARKGGTSLHKYGMKTRPRTASEGESHFRSGRTPES
PTKARGRFTMPQRTGSGSLRPASMHRVVQPISNSPPIPNSPLSESPLGVSDDRYPSYPQP
LHASDPNLSDEYPSFGTSPSDHLIARFSGSGRSRTPDSPTRTPIREESLEFTDEYMNMAP
SGATKAILTTPIFTCQPSHHHTTNIGGRAPSPDHGYITLRPVHITISPPPPPSPSERNIS
PPRSPQTFSPPTDEDQSYMSMNPMSRGSRGSSHYNQPTQAPPQLAQRSASISGRLMTVPP
NQGDEGYMMMAPRTAAQKRGSTGSREAVMKRGNTTDGRDALKPLASDTDQAYTMMQPIPK
HHGNSTVHDGIASKATGHVPKAPTPNSHGKSRGSFSSVPGAIKPSEQKMKPSEILVRSMS
DSKEPILDTYMTMEFQPKDSKTKSPDISKTGNLSPGLDNIDENKNRKSDYVNVSLRDSSP
KPGDSEYTFMVPSSRPVNARKESDKGRSQSAVESLLRGTQKAEVASRGSEYMNVEFSKGG
MPSGEMPARPVPPIPARIPAGKRDDGEYMNVEPGLSVRPHSPRSPTSPPVLPQRMNVLPP
RNPSPGTPPGAYSPSLSGGGAGRRAADLKVGVEELTLSDGSPGNSAPTSLGSASSLTSGN
KSCEPSPGPPSRHSSCRSSQTSLADRELNYIDVDIGQPDTNSSAIPLERRARSPFTRRAA
EEDKSAKPTNYATIDFTKSEGLRSATSTRENRPL
NT seq 3165 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgcagaaggaaaacataccaggagcaggagacgggtcagacattgtcaagtgt
ggctacttaaagaagttcaagacgatgcgaaagaagttctttgtgctccgttgtgagagc
agttcgtgccctgcccgtctggagtactatgacagcgagaagaagttcagggcgggggcg
ctctgcaagcgcaccattgacctcaagacgtgcttcaacatcaaccgcaagacagacagc
aagcaccggcacgccatcgcgctctacacgcgcgacgactgctttgtggtggtcgccgag
gatgagaactcactcaacgagtggttgcaggaactgttgctgcagcagcaagctgaaaat
gacggcatgcccatgccggcctttgaacatgtctggcaggtaacagtgaaacctaaagga
cttggttctagcaaaggactgagtgggaactatcgtctctgcctaacggccaccaccgtt
aaccttgttaagatgaactgcgaaaatgaggacctagaattcccactttcagccatcagg
agatgcggtcactcggattgcttcttcttcatggaggtcgggcggcagtcagtgacgggt
accggagaaatttggatgcaggtggaggacaccgtgatagcacagaacatccatgaggcc
tccttgaacgcgatgcgctccatcagccagcaggaggaggagatgcgaccccgcagccag
agcagcggtaacacctcggaggccaaaccaggctcttcccgccgacaggtggccaccctg
ggcccctcctggcgcacccggtgtgaatccatgccagcccagaaccgcccacgcatgggc
cgatcccgcctgggcagcgagagcgaggagagccttcaagaagaacctagcccaacaagt
gcaccgtcgggttcagcgttgacgtcgtcagtgatacgccctcggactcagagcgagggg
gaggggaaccacaccgcccgcaaaggcgggaccagcttgcataagtatggtatgaaaaca
cgccctcggacggccagtgaaggagaatcacattttcgcagtgggcgtacacccgaaagt
cccaccaaggccagagggcgctttaccatgccacagcggactggttccggcagcctacga
ccggccagcatgcatcgtgttgtgcagcccatttccaactcaccacccataccaaacagt
cctctgagcgaaagccctcttggtgttagcgacgatcgttatccttcttatccccagccc
ctgcatgcctctgaccccaatctctctgatgagtaccctagcttcggaaccagtcccagt
gaccacctcattgcacggttttcgggatctggacgtagccggacgcctgactcaccaacc
cgcactccgatcagagaggagagcttggagtttaccgatgaatacatgaatatggctcct
tctggagccaccaaagctatcctgaccactcccatattcacctgtcagccctcacaccat
cacacaacaaacatcggagggcgggctccatcccctgaccacggctacatcacgttgcgg
ccagttcacatcaccatttcaccaccaccacccccatcaccgtctgagagaaatatttca
ccacctcgatcaccccagaccttttcaccaccaacagatgaggaccagtcgtacatgtcc
atgaacccaatgagcaggggatcacgggggtcgtctcattataaccaacccacccaagcc
ccgccccaactggcccagaggtctgccagcatcagcgggcgattgatgacggtcccgccc
aaccaaggggatgaaggctacatgatgatggccccaaggacagctgctcagaaacgaggc
agcaccggaagtcgtgaggctgtgatgaaacgaggcaatacgacagatggccgtgacgct
ttgaagcccctggcctcggacactgaccaggcctacacaatgatgcagcccattccaaag
caccatggcaacagcacagtgcatgatgggatagcaagcaaagccactgggcatgtcccc
aaagcgccaactcccaacagccatgggaagtcgcgtgggagtttttcgtcagtgcctggt
gccatcaagccctctgagcagaagatgaaacccagtgagatccttgttcgcagtatgtct
gattccaaggagcccatcttggacacatacatgaccatggagttccagcccaaagacagt
aaaacgaaatcgcctgacatttcaaaaactggtaacctaagccctgggttggataatatc
gatgagaacaagaaccgtaaatcggattatgtgaatgttagcttacgagactcatctccc
aagccaggggatagtgaatatactttcatggttccttcctcaagaccagtgaacgcgagg
aaagaatctgataaaggacggagtcagtccgctgtcgagagtctactgagaggaacccag
aaagcagaggtggcttcacgggggagcgaatacatgaatgtggagttctcaaagggtggg
atgcctagtggagagatgccagctagaccggtgccacccattcctgcacggataccggcc
gggaagcgggacgatggggagtacatgaatgtggagccggggctgagcgtccgaccgcac
agcccgcgctcgcccacatcgccacccgttctcccacagcgaatgaatgtcctaccacca
cggaaccccagccctggaaccccacccggtgcgtactcacccagcctatcaggaggtggg
gcaggtcgtcgagcggccgatctgaaagtgggtgtggaggagctgaccctgagtgatggg
tcaccaggcaactctgccccaacctccctgggcagcgccagctcactgacgtccggtaac
aagagctgcgagccctcccccggccctccatcgcgccactcctcttgccgatccagccaa
acctccctggctgaccgggagctgaactacattgatgtggatattggtcagcccgacacc
aacagctctgccataccgctggagcggcgtgctcgctcacccttcacacgtcgagcagcc
gaagaggataaatcggctaagccgacaaattacgccacgatagacttcaccaagtctgag
ggcttacgcagtgcaacttcaacacgagaaaacagacccttataa

DBGET integrated database retrieval system