KEGG   Acanthaster planci (crown-of-thorns starfish): 110985778Help
Entry
110985778         CDS       T05078                                 

Definition
(RefSeq) fatty acid desaturase 2-like isoform X1
  KO
K10226  acyl-CoA 6-desaturase (Delta-6 desaturase) [EC:1.14.19.3]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00592  alpha-Linolenic acid metabolism
aplc01040  Biosynthesis of unsaturated fatty acids
aplc01100  Metabolic pathways
aplc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    110985778
   01040 Biosynthesis of unsaturated fatty acids
    110985778
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aplc01004]
    110985778
Enzymes [BR:aplc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     110985778
Lipid biosynthesis proteins [BR:aplc01004]
 Desaturase
  Front-end
   110985778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase Cyt-b5
Motif
Other DBs
NCBI-GeneID: 110985778
NCBI-ProteinID: XP_022102778
LinkDB All DBs
Position
Unknown
AA seq 469 aa AA seqDB search
MSAHKIQTRCITDAGKMGKGSNRTRTKAEETQASNLKIISWDEVNKHNGRDKEDPSKWLV
IDGLVYDVTEWSRKHPGGSRLLTHYAGQDASEPFTAFHPNKEKVQKYLKALKVVGKTQQR
EERRDIEEDFKNLRSTATKMGLFEANYFFFFLMTVQVIFFDLFAYFNMCYFGAGWGTFIA
AALLTSTAQVQAGWFQHDLGHLSVFKTGKWNRASHALIMGLLKGASKNWWNHMHYQHHAK
PNVMNKDPDVRLEALFVVGENMPKKVAKKDAAKGKATMPYNHQHKYFFIIGPPLLFPVYF
QFMTFYYCFTRKEWVDLFLMVTYYVRFALFYVPLLGVWKTLLLFETMRVLESIWFTWVAQ
SNHIPMTIEEDQEKPWLELQLGATCNIHKSWFNDWFTGHLNFQIEHHLFPTMPRHNLHRI
APLAQALCKKHGVEYKLKGLGSAFVDIVSSLEKSGKIWFDAYYSLRHEL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcacaagatacagacccgttgcatcaccgatgcaggtaagatgggtaaaggg
agcaaccgtacacggaccaaagcagaagagacacaggcatccaacttgaaaatcatatct
tgggatgaagtgaacaaacacaatggcagagataaggaagacccaagcaagtggctggtg
attgatggtctggtgtatgatgtgacagagtggtctagaaagcacccaggaggctccagg
cttttgacacactatgctggccaagatgcttcagaaccattcactgccttccatcccaac
aaggaaaaagttcagaagtacctaaaggcactgaaggttgtgggcaagacacagcaaaga
gaggaacggagggacattgaagaggatttcaaaaatttgagaagcacagctacaaaaatg
ggcctgtttgaagccaactactttttcttcttccttatgacagtacaggtcattttcttt
gacctctttgcatactttaacatgtgttactttggggctggctgggggaccttcattgca
gctgcacttctgacttcaactgcacaggttcaagcgggatggtttcagcatgacctgggc
catctgtctgtcttcaagactgggaagtggaatcgtgcctcccatgcattaattatggga
cttctgaagggtgcctcaaaaaactggtggaatcacatgcactaccagcaccatgcaaaa
ccaaatgtgatgaataaggatcctgatgtaagactggaagccctctttgtggttggtgaa
aacatgcccaagaaagttgccaagaaagatgctgcaaagggaaaggctaccatgccttac
aaccatcagcataagtacttctttatcattggcccacctcttctgtttccagtctacttc
cagttcatgacattttactactgttttacccgcaaggagtgggtggatctatttcttatg
gtcacgtactacgtccggtttgctctgttctatgtgcccttgcttggtgtctggaagact
ctgctgctgtttgaaactatgagagtgttggagagcatatggtttacctgggtagcccaa
tctaaccacatacccatgactatcgaggaagatcaggagaagccatggctggaactgcag
ctgggtgccacatgtaacatccacaagtcctggttcaatgactggttcacaggacacctc
aatttccagattgaacaccacctttttcccaccatgccacgtcacaaccttcaccgtatt
gctccactggcgcaagcactctgtaagaaacatggcgttgagtacaaactgaaaggcctt
ggatcagcctttgtagacatcgtgtcgtccctggaaaagtctggcaagatctggtttgat
gcctactacagccttagacatgaactctga

DBGET integrated database retrieval system