KEGG   Acanthaster planci (crown-of-thorns starfish): 110985886Help
Entry
110985886         CDS       T05078                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase K-like isoform X1
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    110985886
Enzymes [BR:aplc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     110985886
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 110985886
NCBI-ProteinID: XP_022103018
LinkDB All DBs
Position
Unknown
AA seq 759 aa AA seqDB search
MGTASSRRAAGSTGPSSDVVWIGPRNYVTRMEPRRYHFFDGDEARRPSRINPALEERRTP
TPPPTDAQLKVENCNLQPASNKFLHYTAELDEVDWLVVRRGQPFQLDLTLNRPYDKSTDD
IKFDFQTGSTKNFQKGTQVLVSIRDPRPSLAGGWKAEIKEEKENTLTVSVTASASALVGK
YHLTVRTTVKSAEDSNQPQNHSFKEHRPICLLFNAWCEEDQVYLDKEEERKEYVLNERGY
IWYGNSRQLGKRPWGFDQFEKGVFDAVMYLLETHVDQYERGSSVLVSRSMSAAVNSQDDN
GVLSGRWDGNYKPHASPSSWSGSQHILEEHFKTKSPVRYGQCWVFSGVLTTVLRCLGIPA
RSVTNFASAHDTDNSLTIDRYYDENGERMKQYESDSIWNFHVWNEAWMSRPDVPPGYGGW
QAVDATPQETSGDIYRAGPCSVSSIKQGQVYYPYDARFVFAEVNGDIVNWQVKNDHEFEV
MSIKKSSVGKNISTKAVGSRDRQDLTREYKHPEGSAAERAAVKTAVSFGTSPWVYDHPEN
TEDVHAELELPDLWVGADFEVKVPLTNRSQENRSVSITVIVQVVYYTGVLAAKIKKMDKK
FQLGPGQSDQITMSVNADEYLDKMVDQSAFKIFLLGHVDETGQAFVEEEDFRLRTPDLDV
KLLRPAANDVRVGEPVEVELNLSNPLKKNLTNCEVTVEGAGLLPPRVMKQKDVVGSGTLT
LKVDFKPRKAGERTLVATFDSDQLSQVTGELDLNVLKAE
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atggggactgcatcaagcagacgggctgcagggagtactggtccttcctcagatgttgtt
tggattggcccaagaaattatgtgaccagaatggagccaagacgctaccatttctttgat
ggtgatgaggctcgtcggccctcccgtattaacccagccctggaggagaggcggacccca
acaccgcctcccaccgatgcccagctgaaggttgagaactgcaacttgcagccagcaagc
aacaagttcttgcactacactgctgagctggacgaagtggattggttagttgtcaggcga
ggacaaccattccagcttgacctgaccctgaaccgcccatatgacaagagcaccgatgat
atcaaatttgactttcagacaggaagcaccaagaatttccagaagggaacacaggtgctg
gtgtctattcgggatccacgcccatctttagctggaggatggaaggcagaaatcaaagag
gagaaggagaacacgctgacggtgtccgtcactgcatctgccagtgctctagtaggaaaa
taccacctcactgtgcggaccactgtcaaatcagcagaggactccaaccaaccccagaat
cactcattcaaggaacatcgtccgatctgtctcctctttaatgcctggtgtgaggaggat
caagtctacctggacaaggaggaggaacggaaggagtatgtgttgaatgagaggggttac
atctggtacggcaactcaagacagctgggcaagagaccctggggtttcgaccagtttgaa
aagggtgtctttgacgcggtcatgtacctactagaaactcatgttgatcagtatgaacgt
ggaagttctgtcctggtctctcgttccatgtcagctgctgtgaattcccaggatgataat
ggagtcttgagtggacgttgggatggcaactacaagcctcatgctagtccatcctcgtgg
tcaggcagccagcatattcttgaggagcacttcaagaccaaaagtccagttcgttatggc
cagtgctgggtgttctctggtgtcctcaccaccgtgcttcgatgtcttggcattcccgcc
aggagtgtcaccaactttgcatctgcccatgacaccgacaacagtctgaccattgacagg
tactatgatgagaatggtgagaggatgaaacaatacgagagtgactccatctggaatttc
catgtctggaatgaagcttggatgagccggccagatgtcccaccaggctatggcggatgg
caagccgttgacgctacaccccaagaaaccagtggggatatctaccgtgctggtccgtgc
tccgttagttccatcaaacagggccaagtgtactatccctacgacgcaagatttgtcttt
gctgaagtcaatggagacattgttaactggcaggtcaaaaacgaccatgagtttgaggtg
atgagcatcaaaaaaagcagtgtggggaagaacataagcacaaaagcagtgggctcaagg
gacagacaggatcttacacgggagtacaagcaccctgaaggctctgcagcggaaagagct
gccgtcaaaactgcagtttctttcggcaccagtccgtgggtatacgaccatcctgagaac
acagaggatgtacatgctgagcttgaattgccagacctgtgggtcggggcagattttgaa
gtcaaagtccctctaactaataggagccaagaaaacagatcagtgtcgatcaccgtcatc
gtgcaagtggtatactacactggtgtattggctgccaaaatcaagaagatggataagaag
ttccaacttggacctggtcaaagtgatcagataactatgagtgttaatgctgatgagtat
ctggacaagatggtggaccagtctgcattcaaaatcttcctcctcggccatgttgatgag
actggccaggcctttgtagaagaggaagacttccgtctgcgtacccctgaccttgacgtc
aagctgttgcgcccggcggccaatgacgtgcgtgtcggcgagccagttgaagtagagctg
aatctatccaatcccctgaagaagaatctgacgaactgtgaggtcaccgtggaaggggca
ggattgttgcctccccgtgtcatgaagcagaaggacgttgtgggtagtggaacgctcact
ctgaaggtcgacttcaaacctcggaaagccggggagaggacactagttgccacctttgat
tcagatcaactctcccaggtgaccggtgagctggatttaaacgttctgaaggccgagtga

DBGET integrated database retrieval system