KEGG   Acanthaster planci (crown-of-thorns starfish): 110986154Help
Entry
110986154         CDS       T05078                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00052  Galactose metabolism
aplc00500  Starch and sucrose metabolism
aplc01100  Metabolic pathways
aplc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110986154
   00500 Starch and sucrose metabolism
    110986154
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110986154
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aplc04147]
    110986154
Enzymes [BR:aplc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110986154
Exosome [BR:aplc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110986154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 110986154
NCBI-ProteinID: XP_022103496
LinkDB All DBs
Position
Unknown
AA seq 686 aa AA seqDB search
MKLCEMQSLRAVGCHRAIFGIAFISYLLSGVTLTSGMQCSGIASSFRFDCHPEEDASQQE
CQRRGCCWLASKNLDEGVPYCFYPSDFPTYQMGSPQQTAFGYTVMLKRTTKSYYPNDVMQ
LQMDLYFETSYRLHFKIYDPKSKRYQVPVPTPKVSKRVPSTDYKVQFLWSPMGLIVTRRV
DGTVIFNSTLSPLIFADQFLQLSTSLVTPYIYGLGEHRGRFRVASDWETYPMWSRDQPPH
VGDNLYGVHPFHLGLEGSSGNSHGVFLLNSNAMEVVLQPAPALTYRTIGGILDFYIFMGP
GSDQVVQQYTEVIGHPFMPPYWGLGFHLCRWGYGSSNRTLEIVKRMRAASIPQDTQWNDI
DYLDGRKDFTINSGPYSGLPEMVKYLHSIGMHYIPIIDPAICSTQPAGTYPPYDTGIAQD
VFIKDSNGKPIVGKVWPGSTVFPDFFNNKTKSWWLDQIRNFHGKVPIDGLWIDMNEPSNF
VDGSVDGCSTDPYNNPPYTPATLLGGKLDSRTLCASSTQAIGKHYDLHSLYGYSESIATN
EALVEVRNKRSFVISRSTYPGSGKYTGHWLGDNYSLWPDMAYSIAGILSFNLFGIPLVGA
DICGFNLDTTEELCQRWMQLGALYPFSRNHNTLGAKDQDPTSFSQDMQTSTRNALQLRYS
LLPYIYTLFHLAHTQGSTVARPLFFE
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttgtgaaatgcagtcactgagagctgttggctgtcatcgagccatctttggt
attgccttcatcagttacctgctatcaggggttaccctgacatctggtatgcaatgctct
ggtattgcttcatctttccgctttgattgccaccctgaagaggacgcaagtcaacaagaa
tgccagcgacgtggatgctgttggctggcatccaaaaacttggacgagggcgttccctac
tgtttctatccatcagatttcccgacctaccagatgggctcaccgcagcaaacagcattt
ggttacactgtgatgttaaaacgtactaccaaaagttactatccaaatgatgtgatgcag
cttcaaatggatctttactttgagactagctacagattacacttcaagatatacgacccc
aagtctaaacgttatcaggttcccgtccctacaccaaaagtcagcaagcgagtgccatca
acagactacaaagtgcaattcttatggtctccaatgggcttaattgtcacccgtcgagtg
gatggtaccgtaatattcaacagtaccctaagtcccttgatttttgcagaccagttcctt
caactctcaaccagcctggtcacaccatacatctatggtcttggagaacacagaggtcgt
ttcagggttgcttcagattgggagacctatccaatgtggtcaagagatcaaccccctcat
gttggtgataatttgtatggagtgcatccgttccacttgggtcttgagggcagttcaggc
aactcccacggtgtcttccttctcaacagtaatgccatggaggtcgtgctacagcctgct
ccagcactcacctaccggaccatcggtgggattctggacttctatatcttcatgggtccc
ggatcggaccaagttgtccagcagtacaccgaggtcattggtcatccatttatgcctcct
tactggggtcttggatttcatctgtgtcgctggggttatggatcatcaaacaggaccttg
gagattgtcaaacggatgagagctgcttcaattccacaggacactcagtggaacgacatc
gattacctagatggacgaaaagacttcacgatcaacagcggaccatattcaggactgcct
gaaatggtcaagtatcttcattccattggcatgcattatattccaatcatagacccagct
atctgcagtactcaacctgctgggacatatccaccgtatgacactggtatcgcacaagat
gtgttcattaaagacagcaatggaaaaccaattgttggaaaggtgtggccgggttcaact
gtattcccagacttcttcaacaacaagaccaagagctggtggcttgatcaaatcaggaat
ttccacggcaaagtgcccattgatggactgtggatagatatgaacgagccttctaacttt
gtggatggttctgttgatggttgctctacggatccgtacaacaacccaccctacactcca
gctacactacttgggggcaagctagattcaaggaccctgtgtgcttcctccacccaggct
atcggcaagcactatgacctccatagtctttatggatattcagaatccattgccacaaac
gaggctctggtggaagtacgcaataaaagaagttttgtcatctcaagatcaacttaccca
gggagcggcaaatacactggtcactggctgggagataactatagtctatggccagacatg
gcttattctatagcaggcattttatccttcaatttgtttggcatacctctggttggcgcc
gatatatgtggcttcaaccttgatacaacggaagaactttgtcagcgatggatgcagcta
ggggctctctatccattctctcgcaatcacaacacactcggagctaaagatcaggatcca
acttcgttcagtcaagatatgcagacttcaaccaggaatgctcttcagctacgctacagc
ctcctgccatacatctataccctgttccaccttgcacatacccagggctccactgtggcc
agacctttgttctttgagtaa

DBGET integrated database retrieval system