KEGG   Acanthaster planci (crown-of-thorns starfish): 110986692Help
Entry
110986692         CDS       T05078                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00020  Citrate cycle (TCA cycle)
aplc00190  Oxidative phosphorylation
aplc01100  Metabolic pathways
aplc01200  Carbon metabolism
Module
aplc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aplc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aplc_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110986692
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110986692
Enzymes [BR:aplc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110986692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 110986692
NCBI-ProteinID: XP_022104489
LinkDB All DBs
Position
Unknown
AA seq 663 aa AA seqDB search
MATILKLPCRSGVSLLGRLTKPATSSLGARPFHFTVEGRQTGGTAKTGSISHDYPVVDHT
FDAVVVGAGGAGLRAAFGLAQEGFRTACVSKLFPTRSHTVAAQGGINAALGNMEPDNWRW
HMYDTVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRTEEGKIYQRAFGGQSYDYG
KGGQAHRCCAVADRTGHSLLHTLYGQSLRYDCEYFIEYFALDLIMEDGVCQGISTLCLED
GTIHRIRAKNTILATGGYGRAYFSCTSAHTCTGDGTAMITRAGIANQDMEFVQFHPTGIY
GAGCLITEGCRGEGAILINSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPLK
DHVFLQLSHLPPQQLATRLPGISETAQIFAGVDVTRDPVPVLPTVHYNMGGIPTNYKGQV
IVYENEEDKVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACAHTIIEQNQPGEAM
PELKPNAGEASVANIDKLRFADGNTKVADIRLNMQKIMQNNAAVFRTGETLKEGVDLIMD
SYKTMEDMKLYDRGIVWNTDLIEALELQNLMINSVQTMVAAEARKESRGAHAREDYKSRI
DEYDYSKPLEGQTPKPFEEHWRKHTLSDMNVESGKVDLLYRPVIDKTLNQEDCSTVPPAV
RSY
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggccacgattttgaagttaccctgccgatctggcgtgagtttacttggtcgattaaca
aaaccggcgacatcatcccttggtgccaggccattccatttcacagttgaagggaggcaa
acaggaggaaccgcaaaaactggatcaatttcccacgactacccggtagtggaccacaca
tttgatgcggtagtagtgggagcagggggcgcggggctgcgagctgccttcggcttggcc
caggaaggcttcaggacggcatgtgtatccaaactgttccctacacgatcacacacagtg
gctgctcagggtggcatcaatgctgcattgggcaatatggaaccagataactggagatgg
cacatgtatgacacagtcaagggttctgattggctgggagaccaagatgcaatccattat
atgacagaagaagcaccaaaggctgtcattgagctggagaattatggcatgcccttcagc
cgcacagaggaaggcaagatctaccagcgagccttcggtgggcagagctatgactatggt
aaaggaggccaggcccatcgctgctgtgctgtagcggaccgcactgggcattccctactc
catacactgtatggccagtccctgcggtatgactgtgagtacttcattgagtactttgca
ctggatctaatcatggaggacggggtgtgtcaagggatcagtacgttgtgtctggaagat
ggtaccatccacaggatacgggctaaaaacaccattcttgcaactgggggctatgggcgt
gcttatttcagctgcacttcggcccatacctgcaccggggacggcactgccatgataacc
agagctggcatagccaatcaggatatggagtttgtgcagttccatccaacaggcatctac
ggcgctggctgcctcatcactgagggttgccgtggcgagggtgccattctcatcaacagt
gaaggcgagcgcttcatggagcgctatgccccgacggctaaggacttggcgtcccgtgac
gtcgtctcgcgctccatgaccatcgagatccgggagggacgtggggttggccccttgaag
gaccacgtcttcctgcagctttcccatctgccacctcagcagcttgccacccggctaccg
ggcatctctgagacagcccagatctttgccggtgtggacgtgacacgggacccggtgccc
gtgctgcccacagtgcactacaacatgggtgggataccaaccaactacaagggacaggtg
atcgtgtacgagaacgaggaagacaaggtggtgcctggcctgtacgcctgcggggaggca
gcttgcgcatcggtccacggagccaaccgcctgggggccaactcacttctggatctggtt
gtctttgggcgtgcctgtgctcacaccatcattgagcagaaccagcctggtgaagccatg
cctgaactgaaaccaaatgctggtgaagcttccgttgccaacattgacaagctgcgcttt
gccgatggcaacactaaggttgctgatatcaggctgaacatgcagaagattatgcaaaat
aacgctgctgtgttccgcactggcgagacgttgaaggaaggagttgacctcatcatggat
tcatacaagaccatggaagacatgaagttgtacgatcgtggcattgtttggaacaccgac
cttatcgaggccctggagctgcagaatctgatgattaactccgtacagaccatggtggca
gcagaggcacgcaaggagagccgaggggcacatgcgagggaagattacaagagtcgtatt
gatgagtatgactacagcaagcctctggaggggcagacaccaaagccttttgaggagcat
tggcggaaacacaccctgagcgacatgaacgtggagagtggaaaggttgacctgttgtac
agacccgtgattgacaagactttaaaccaggaagactgttcaaccgttccacctgccgtt
cgctcatattaa

DBGET integrated database retrieval system