KEGG   Acanthaster planci (crown-of-thorns starfish): 110986798Help
Entry
110986798         CDS       T05078                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00052  Galactose metabolism
aplc00500  Starch and sucrose metabolism
aplc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110986798
   00500 Starch and sucrose metabolism
    110986798
Enzymes [BR:aplc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     110986798
    3.2.1.20  alpha-glucosidase
     110986798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 110986798
NCBI-ProteinID: XP_022104698
LinkDB All DBs
Position
Unknown
AA seq 958 aa AA seqDB search
MSREETMVKGSMDIDDGYASKSGSGRVGMVVIAVVLTALAVAAVTVPVTYFFHPDYLKNQ
SPEPTQAPPTPTEAVDDYMRVNCHPGWEEGTEAECNRRGCRYSAPVADQGAPKCFFPKNY
GGYRMVGKEAETPSGYRITLDRIPSTPTLFDADIGRLILDIEFQTEYRLRFKFYDPANKR
FEVPLDMPQASGTKPARMMYHVAFTSDPFTLKITRKDTGTILWDTSLGPLIFSDQFLQIT
TTLPSSNLYGFGENEHPSFRHNIQWTSWGMFSRDQPPGGDANLYGVHPFYMSLEEDYKAH
GVLLLNSNAMDVAFQPTPALTYHTIGGILDFYMFLGPTPENVVQQYTEAIGRPYMPPYWA
LGFQLCRYGYNSLDRVKEVVAGMRKYDIPLDIQYGDIDYMDRQMDFTIGQNYQGLGDFVD
ELKANGTHYIIILDPAIAANETAGSYPAYDEGVTGDVYIKGPDGESDLYGKVWPDLPGVV
VDPNQDWDYQVKNYRAYAVFPDFRKQSTQDWWTNQILAFYNRVKFDGIWIDMNEPANFVE
GSTEGCTDNKYDRPPYRPRIWGNLAEKTVCMNAMQHRTISEKTMHYNMHSLYGWSQSSPS
LVANERATGKRGIVISRSTYPGSGKYVGHWLGDNTSKWPDMHKSIIGMLEFNLFGIPYIG
ADICGFFQDTTESLCRRWSLLGAFYPFARNHNGLNNIPQDPASFGEEFAKDVRDVLLIRY
TLLPYLYTLFYEAHTMGSTVVRPLMHEFTSDSVTWDIDRQFLWGPALLISPVLDEGTEFV
EVYVPEGPWYVYQTGTQVIRSYEKTTVSMYTPMDEINIHVRGGWILPTQEPANSTVYSRT
NPFGLIVALDDSQKATGKLFWDDGETKGTIESGDYFIAKYIAGNRVLQSTITDPNPSLMA
DLVMDDIKIWGVKSLVSKVLYQNVELNSLRWNFNQANMVLTIENLNHPMTDNIILEWQ
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgtccagagaagaaacgatggtgaaaggaagcatggacattgatgatggctatgcctcc
aagagcggatcaggccgagttggtatggttgttatagccgtggtgctcacggcgctggcc
gtggccgcggtgacggttcccgtcacctacttcttccaccctgactacttgaaaaaccag
agccccgaacccacccaggctcccccgaccccaacggaggcagtcgacgactacatgagg
gtcaactgtcaccctggatgggaggaggggacggaggcggagtgcaacaggaggggttgc
cggtactccgcgcccgtggctgaccagggggcccccaagtgcttcttccccaagaactac
ggcgggtaccgcatggtgggcaaggaggccgaaacgccgtccgggtaccgaatcacgctg
gaccgaatcccgtccacgcccaccctcttcgacgctgatatcggtagactcattctggac
atcgaatttcagaccgaatatcggctacgatttaagttttatgatcctgctaacaagcgg
tttgaggtcccgttggatatgccccaagcttctgggaccaagccagcaagaatgatgtat
cacgtagccttcacctcagatccattcaccttgaaaataactcggaaggacactggtacc
attttatgggacacgtcgttgggccccctcatcttttctgatcagttccttcaaatcacc
accacccttccctcctccaatctctacggtttcggcgagaatgaacacccgtctttccgc
cacaacatccagtggacatcgtggggcatgttttctcgcgatcaaccgccgggcggtgat
gccaatctgtacggtgtccatccattctacatgagccttgaggaagactacaaagcccat
ggggtgttgctactcaacagcaatgcgatggacgtagcattccaacctacaccagctctg
acctaccatactatcggaggcattttggacttctatatgttccttgggcccactcctgag
aacgttgttcagcaatacacagaggcaatcgggcgtccctacatgccgccatactgggca
cttggtttccagctttgtcgctatggttacaattctttggacagagttaaggaagttgtg
gcaggcatgcgcaagtatgacatcccattggacatacagtatggtgacatcgactacatg
gacagacagatggatttcaccatcggccagaactaccagggactcggggactttgtggac
gaactcaaagccaatggcactcattacatcattatcttggatccggccattgctgccaac
gagaccgctgggtcgtatcccgcatatgacgagggcgtgaccggtgacgtctacatcaag
ggtccagacggggaaagtgacctgtatggaaaggtatggcctgatctaccaggcgttgtt
gtcgatccaaaccaagactgggattatcaagtcaagaattaccgtgcctatgctgttttt
cctgacttccgcaaacaaagcacacaagattggtggaccaaccaaattcttgctttctac
aaccgagtcaagtttgatggaatctggattgacatgaatgaacccgcaaactttgtcgaa
ggatcaacggaaggttgtaccgacaacaaatacgacaggccgccataccgtccaagaatt
tggggtaacttggctgagaagacagtctgcatgaatgccatgcaacatcgcaccatttcg
gaaaagaccatgcactacaatatgcacagtctctatggttggagtcagtcatcaccttcc
cttgtcgccaatgaaagagcaacaggcaagcgaggcattgtcatctctaggtctacctac
ccagggagtggcaagtacgttggccactggctgggggacaatacaagcaagtggcctgat
atgcacaagtcaatcatcggtatgcttgagttcaatctgtttggtattccttacatcggt
gcagacatctgcggctttttccaggacaccaccgagtctttgtgtcggcgctggagcctg
ctaggggcattctacccctttgccagaaatcacaacggcttgaataatatacctcaagat
ccagcctcttttggggaggaattcgccaaggatgtgagagacgttcttctgatccgttac
accttgctgccgtatttatacactttgttctacgaggcacacaccatgggatctactgtg
gttagaccgcttatgcatgaattcacctcagacagtgtaacgtgggacattgatcggcaa
ttcttgtgggggcctgccctcctcatcagcccagttttggatgagggaacagaatttgtg
gaagtttatgtccctgaaggaccttggtatgtctaccaaacgggcacccaggttattcgg
agctatgagaagacgaccgtcagcatgtacacccctatggatgaaatcaacattcacgtg
cggggtggatggatattgcccacccaggaaccggctaattctaccgtgtacagtcgcacc
aatccatttggactgatcgttgccctggacgattcccagaaggcaacggggaagctattc
tgggatgacggcgaaacaaaaggcactattgaatctggagactattttatagcgaaatac
attgcaggaaatagagtcctccaatccaccatcacggatcccaatccatcactgatggcg
gatctggtgatggacgacatcaagatctggggcgttaaaagtttggtcagcaaagtcttg
taccagaatgtagagctgaattcccttaggtggaatttcaatcaggctaacatggtctta
acaatcgaaaatttgaatcatccaatgactgacaacatcatcctggaatggcagtag

DBGET integrated database retrieval system