KEGG   Acanthaster planci (crown-of-thorns starfish): 110986840Help
Entry
110986840         CDS       T05078                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, mitochondrial-like isoform X1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00020  Citrate cycle (TCA cycle)
aplc00310  Lysine degradation
aplc00380  Tryptophan metabolism
aplc01100  Metabolic pathways
aplc01200  Carbon metabolism
Module
aplc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aplc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aplc_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110986840
  09105 Amino acid metabolism
   00310 Lysine degradation
    110986840
   00380 Tryptophan metabolism
    110986840
Enzymes [BR:aplc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     110986840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 110986840
NCBI-ProteinID: XP_022104769
LinkDB All DBs
Position
Unknown
AA seq 1011 aa AA seqDB search
MHRFKTLWTFGQLRPVNFRTLWLSGMRAGCGHGQQSWRCYVTPVATEPFLSGSSSNYVEQ
MYQSWLEDPKSVHKSWDIFFRNAQNGAAPGMAYTSPLVPTPAIYQAPAQSVSPIPVRALG
APLDKRVIEDHLSVQTIIRSYQIRGHNISNLDPLGINNADLDGETPKELLTKNYELGEHD
MDRVFTLPQTTFIGGEQTALPLREIIRRLEDTYCRSIGVEYMFINDRQQCDWIRERFETP
GAMQFTKMDKRLILERLIRSTRFEEFLARKWSAEKRFGLEGCEVLVPALKSIIDVCSGQG
VESFVIGMPHRGRLNVLANVARKPLEHLFCQFDSKLEAADEGSGDVKYHLGMSHSRLNHI
TKKDIHIAIVANPSHLEAVDPVVQGKVRAEQFYRGDTEGKRVMSILMHGDAAFAGQGIVY
ETFHLSDLPDYSTHGTIHVVVNNQIGFTTDPRYARSSPYCTDVARVVNAPIFHVNADDPE
AVMYVCQIASQWRCTYGKDVVIDLVCYRRNGHNEMDEPMFTQPLMYKKIRSHQPVLSTYA
EAKIKEGVMTQQEFEEELAGYDKICEDAYQNAKTIAHVKNSDWLDSPWTGFFKSDVPLRY
PPTGISEDILRDIGEKFSSVPEDYNLHGGLKRVQRSRLDMVKNRAVDWALGEALAFGSLL
KEGIHVRLSGQDVERGTFSHRHHVLHDQNVDKKYLSPLNNLYPDQAHYTVCNSSLSEFAV
LGFELGFSMTNPHSLVIWEAQFGDFHNNAQCIIDQFISSGQAKWCRQSGIVMLLPHGYEG
MGPEHSSARIERFLQMSNDDPDVIPALNDDFVVNQLYDCNWQIANCTTPANMFHILRRQI
MLPFRKPLIVFTPKSLLRHPDAKSSFDDMIEGTMFKRVIPEDGVATQNPSNVRKVVLCSG
KVYYDLVKEREKKGLNADIAITRLEQISPFPYDLIIEELNKYPNAKIQWSQEEHKNMGAW
NYVQARIHTASNWKRRCTYAGRAASAATATGNKFTHLIELDNLMSETMKLD
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgcaccgatttaagacattgtggacgtttggtcagctccggccagttaacttcaggaca
ttatggctgtccggcatgagggccggatgtggacatggacaacagtcctggcgctgctat
gtcactcctgtggccacagagccctttctgagtggcagcagttcaaactatgtggaacaa
atgtaccagtcatggcttgaagatcccaaatcagtgcataagtcatgggacatcttcttc
cgcaacgcacagaatggagctgcccccggcatggcatacacttcacccctagtgcctacc
ccagctatataccaggcacctgcccagtcggtcagtcctataccagttagggcactggga
gcacccttggacaaacgtgttattgaagatcacctgtcagtccaaacgatcatccgatcc
taccagattcgtggccataacatttccaatttggatccgttgggaatcaacaatgctgat
ctggatggtgaaacacccaaagagctccttactaagaactatgagttgggtgagcatgac
atggaccgggtgttcactttgccccagacgaccttcattggtggtgaacagactgcccta
ccattgcgggagatcatcaggagactggaggacacttactgccggagcattggtgtggag
tacatgtttatcaatgacaggcagcagtgtgattggattagagagcggtttgaaacgcct
ggtgccatgcagttcaccaaaatggacaaacggctgatccttgagcggctgatacgctcc
accagattcgaggagtttctggcccggaagtggtcggctgagaaacgctttggcctggag
ggatgtgaagtcctggtgcctgccttgaagagcattattgatgtctgcagtggccaggga
gtcgagagctttgtgattggtatgccgcatcgtggtcgtctgaacgtccttgccaatgtt
gcacgcaaacccttggagcacctattctgccaatttgattccaagctggaagcagctgat
gaaggttcaggtgatgtcaagtaccaccttggcatgtcccactcgcgcttgaaccacatc
accaagaaagacatccacattgccattgtggccaatccctctcatctggaggctgtggat
ccggtggtgcagggcaaagtccgtgctgagcagttctaccgaggggacactgagggtaaa
cgggtgatgagcatcctaatgcacggtgatgctgcatttgctggccagggcattgtctat
gagacgtttcatctgtcagacctgccagattactccacccatggcaccatccatgttgtg
gtcaacaaccagattggttttacaactgaccctcgctatgcccgatcctctccctactgc
acagacgtagcccgtgtggtgaacgcacccatcttccatgtgaatgctgatgacccagag
gctgtgatgtatgtgtgtcagattgcctcacagtggagatgtacctatggcaaggatgta
gtgattgacttggtgtgttaccgccgcaatggtcacaatgagatggacgagcctatgttc
actcagcccctaatgtacaagaaaatccgcagccaccagcctgtgctgtccacatatgca
gaggctaagatcaaagaaggtgtcatgacacagcaagaatttgaggaagaacttgcaggc
tacgacaagatctgtgaagatgcttatcagaatgcaaagacaattgcgcatgtcaagaat
tctgattggctggattctccctggacaggttttttcaagagtgatgtgccccttcgctac
ccacccactgggatcagtgaggacattctcagagatattggggagaaattcagcagtgtg
ccagaggattacaaccttcatggaggtttgaagcgtgtccagcgtagtcgcttggacatg
gtgaagaaccgcgctgtggactgggctttaggtgaggctctagcctttgggtccttgctg
aaagaaggcatccatgtcagactgagtgggcaggacgttgagagaggaaccttcagtcac
cgacatcatgttctccatgaccagaatgttgacaaaaagtacctgtctcctctgaacaac
ctgtacccagatcaagcccactacacagtctgcaacagctccctctccgaatttgccgtc
ttaggatttgagctgggtttctccatgaccaacccccattcgcttgtcatctgggaggct
cagtttggtgacttccacaacaatgcccaatgcatcattgaccagttcatatccagtgga
caggcaaagtggtgtcgccagagcggcattgtcatgttgctccctcacggatatgaaggc
atgggaccagagcattctagtgctcgcattgagcgtttcctgcagatgagcaacgacgac
cctgatgttataccagccctgaatgatgactttgttgtgaatcagctgtacgactgcaat
tggcagattgccaactgcaccacaccagccaatatgttccacattctgcgcaggcagatc
atgttgcccttccggaaaccgctcatcgtctttacaccaaaaagtcttctccgtcatcct
gatgccaagtcatcttttgatgatatgatcgaaggaacaatgttcaagcgtgttattccg
gaggatggagtggccactcagaatcccagtaatgtccgcaaggtggtactgtgctcaggg
aaagtgtactatgacctggtgaaagagagggagaagaagggtctcaatgctgatattgcc
atcactagattggaacagatttcaccgttcccatatgatctgatcattgaggagctaaac
aagtatcccaatgccaaaatccagtggtcccaggaggaacacaagaacatgggggcgtgg
aactatgtccaggcacgcatccacacagcgagtaactggaaacgacgctgcacgtatgcg
ggtcgggcagcatctgctgccactgcaactggcaacaagttcactcacctgatcgagttg
gacaacttgatgagtgagaccatgaagttagattaa

DBGET integrated database retrieval system