KEGG   Acanthaster planci (crown-of-thorns starfish): 110990777Help
Entry
110990777         CDS       T05078                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial-like
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    110990777
Enzymes [BR:aplc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     110990777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_8 FAD_binding_2 FAD_oxidored EF-hand_6 Pyr_redox_2 GIDA EF-hand_5 EF-hand_9 Thi4 Pyr_redox_3 Methyltransf_34 Pyr_redox
Motif
Other DBs
NCBI-GeneID: 110990777
NCBI-ProteinID: XP_022111572
LinkDB All DBs
Position
Unknown
AA seq 724 aa AA seqDB search
MASSGRLRKVVIGGGLLGAGALLAGYVVSRNSAQKLSKNRQAHVVAAELRNAHLSMPLPT
REQQMQSLQNTHEFDVLVIGGGATGCGVALDAVSRGLKTALVEMYDFSAGTSSRSTKLIH
GGVRYLEKAIKGLDLEQYRLVKEALHERANLLEIAPHLSSPLPIMLPVYKWWQLPYFWAG
IKMYDLVAGRQCLKPSYLLSKTRALELFPMLKKEKLVGGIVYYDGQHNDARMNIAIALTA
ARMGATVANHTEVLSVIKGKDASGQEVIKGALVRDKMTGKEYSVLAKSVINATGPFTDSV
RKMAEPEATTICAPSSGIHIVLPGYYSPEAMGLLDPATSDGRVIFFLPWQNFTIAGTTDN
PCKVTHNPGPTEDEIQFILNEVKDYLSPEVAVRRGDVLAAWSGIRPLVRDPKAKNTESIA
RNHVIDVSSNKMVTIAGGKWTTYRSMAKDAVDAAIKACNLQPKNDSLTDGLVLEGGHGWT
PNMFIRLIQDFGLDDEVARHLSETYGDKAVEVARMANLTGKRWPVVGKKLAQHFPYLEAE
VAYAVKEYACTAIDVLARRTRLAFLNVMAAEEALPRIIDIMAKELGWSSARQKLELEKAT
RFLNVEMGYNCHSSLLKVPIQFSNEEIAKYTKRFHLLDKDSKGYITPIDMRNFLSSVGET
ITEDQLRDMLQEVDCNKNGRVELDEFLQLMSAIKTGAMANVRLEIALNMGARKVISTDRS
GGGV
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcatctggccgtctgcgcaaggttgtcatcggcgggggcctcctgggagctggc
gcactactggccggctacgttgtcagcaggaactcggctcagaaactctccaagaatcgg
caggcccatgtcgtggctgctgagctgcgcaatgctcacctcagcatgcccctgccgact
cgagagcagcaaatgcagtcactgcagaacactcacgagtttgatgtgctagtcattggg
ggcggagctactggatgtggagtggcactggatgccgtcagtcgcgggctgaagacggca
ctggtagagatgtacgatttctcggcgggcaccagcagccgcagcaccaagctgatccac
ggcggcgtgcgctacctggagaaagcgatcaagggcctggacttggagcagtaccggctg
gtcaaggaggccctgcatgaaagggccaacctgctagagattgcccctcatctctcctcg
ccacttcccataatgctgccggtgtacaagtggtggcagctgccctatttctgggcaggc
atcaagatgtacgacctggtggctggtaggcagtgcctgaagcccagctaccttctctcc
aagacaagagccttggagctatttcccatgctcaagaaggagaagttggtcggcgggatc
gtgtattacgatggtcagcataatgatgccagaatgaatatcgccatcgcactgacagca
gcgaggatgggggcgacagtcgccaaccacacggaggtgcttagcgtgatcaaaggcaag
gatgcaagtgggcaggaggtcatcaaaggagcgctagtcagggacaagatgacaggcaag
gagtacagcgtcctcgccaagtcagtcatcaatgcgacggggccattcacggattccgtc
aggaagatggccgagcccgaggccaccacaatctgtgcacccagctcaggtatacacatc
gtgctgcctggttactacagtccagaagccatgggtctgctggaccctgccaccagcgat
ggccgggtcatcttcttcctgccgtggcagaacttcaccattgccggcacgacggacaac
ccttgcaaggtgacgcacaaccccggacccaccgaggacgaaatccagttcattttaaac
gaggtcaaggattatctcagtccggaagtagcagtgaggcggggtgatgtccttgctgct
tggagtggcattaggccattggtcagagatccaaaagccaagaacacagagtccattgcc
agaaatcacgtcattgatgtcagtagcaataaaatggtcaccatagcaggtggtaagtgg
accacatatcgcagtatggccaaggatgcagtggacgcagccatcaaggcctgcaacctc
caacccaagaacgattcgctgaccgacggcctggtcttagagggaggtcacggatggaca
cccaacatgttcatccgcctcatccaggattttggattggacgatgaggttgcaaggcac
ctgagcgaaacgtacggagacaaggcagtggaggtggccaggatggccaacctgactggc
aagaggtggccagtggtgggcaagaaactggcccagcacttcccctatctggaagctgag
gtggcctatgcagtgaaggagtacgcttgtacagctatcgatgttcttgctcggaggaca
cgcttggcctttcttaacgtgatggcagcggaggaggccttgccccgcatcattgacatt
atggccaaggagttgggctggagtagtgcaaggcaaaagctggaactcgagaaagccaca
aggttcctgaacgtggagatgggttacaactgtcactcctccctcctgaaagtccccatt
cagttcagcaatgaggagattgctaagtacaccaagcgattccatctcttggacaaggac
agcaaggggtacatcacgcccatcgacatgcgcaacttcctgtctagtgttggtgaaaca
ataactgaagaccagctgcgcgacatgctgcaagaagtagattgcaataagaatggacgt
gttgaactggatgagttcctacagctcatgagtgccatcaagacaggtgccatggccaac
gttcgcctggagattgccctgaacatgggagcccgcaaagtgatctcgacagatcgcagt
ggcgggggtgtgtaa

DBGET integrated database retrieval system