KEGG   Acanthaster planci (crown-of-thorns starfish): 110991130
Entry
110991130         CDS       T05078                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B-like
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Pathway
aplc04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110991130
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 110991130
NCBI-ProteinID: XP_022112019
LinkDB
Position
Unknown
AA seq 274 aa
MSSVRVESPLLPEFRRQPSPSCPSRMPKPRACRKLFPVDHDETNRVLQNQLARMREEQRK
EYGFDFDRGEPLPNQDGSSRYIDWEATPEERVSSFYHETVARPGHRHSRLRPLPTPHTSQ
FPQHRSSENGRPNAAICTTTSRHASASLVNRLDAENTRTFRPVQHQDLCPTETNSTTATS
PNPCSTPSSSSESPGRSGTAGRSCATSTNVRTAPTQSQVTDVMKQRKRRRSGSGSTSSGS
NSDADGGKHSHDPAKRRRQLPGSSSVSHSTTGRS
NT seq 825 nt   +upstreamnt  +downstreamnt
atgagctcggtacgggtcgaatcgccgttgctcccggagttccggagacagccgtctccg
tcctgcccatccaggatgcctaagccacgggcctgccgaaagctcttcccggtggaccac
gacgagacgaaccgcgtcttgcaaaaccagctcgcaagaatgagagaggaacagaggaaa
gagtatggcttcgatttcgaccgtggagagccgctgcctaaccaagacggcagcagccgg
tacatagattgggaggcgacacctgaggagagagtgtcttcattttaccacgagacggtg
gcgaggccagggcatcgtcattctaggttaagacccctgccaacaccccacacctctcag
tttcctcaacaccgaagctctgaaaacggacgacctaatgcagccatctgcaccaccacc
agccgccacgcttcagcgtcccttgttaacagactggacgctgagaacacccggacgttt
agaccggtacagcaccaagatttatgcccgactgaaacgaactccaccactgccacatct
cctaacccttgttccacaccctcctcgtcatcagaatcaccgggtcgttcaggaacagcg
ggaagaagctgtgcgacttcgacaaacgtgagaacagcaccaactcaaagccaagtcact
gatgttatgaaacaacgcaagcgaagacggtctggcagcggcagcacgagcagtggttcc
aacagcgatgctgacggtgggaaacactcgcacgaccccgccaagcgacggcgtcagctg
cccggtagctcgtcggtgtcgcactccactacgggtcgttcgtga

DBGET integrated database retrieval system