KEGG   Alpha proteobacterium HIMB5: HIMB5_00007330Help
Entry
HIMB5_00007330    CDS       T02250                                 

Definition
(GenBank) glutamyl-tRNA(Gln) and/or aspartyl-tRNA(Asn) amidotransferase, A subunit
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00970  Aminoacyl-tRNA biosynthesis
apm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apm00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    HIMB5_00007330
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:apm03029]
    HIMB5_00007330
Enzymes [BR:apm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     HIMB5_00007330
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     HIMB5_00007330
Mitochondrial biogenesis [BR:apm03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    HIMB5_00007330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AFS47490
UniProt: J9YWZ3
LinkDB All DBs
Position
complement(662063..663520)
Genome map
AA seq 485 aa AA seqDB search
MSDLTTQTLVKLCKNIKEKKISSTEVTKAFIERSEKSKTLNAYITTDFENALTKAKQFDE
KPNLDLKLPGIPIAVKDLFCTKKVKTTAGSKILQSFTPTYESTVTDNLWNAGGILLGKLN
CDEFAMGSSNETSYYGNVQNPIDENLVPGGSSGGSASAVAAQLTPITIGTDTGGSIRQPA
SFTGTVGLKPTYGSCSRYGIVAFASSLDQAGPMSQNVEDCALLHEVISTFDNKDSTSINF
KRNNYLQELSKNIKGKKIGIPKEYRVEGMPKEIEDLWQKGIDYIKECGAEVVDISLPHTS
YALPTYYIVAPAEASSNLARYDGVKYGFRAEGKNLIDMYEKTRSEGFGAEVQRRIMIGTY
VLSSGYYDAYYLKAQKVRKLIKNDFDEAYKQVDAILTPSTPSSAFKIGEKKDDPVSMYLN
DIFTVPVNLAGLPGISIPAGHDAKGYPLGLQIIGKAFDEQNILNIAYAMEEKIGFKNNIT
DWWIK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatttaacaacacaaacattagtaaaattatgtaaaaatattaaagaaaaaaaa
atttcttcaacagaagtaacaaaagctttcatagaaagatctgaaaaatcaaaaacactt
aatgcttatataactactgattttgaaaatgctttaacaaaagctaaacaatttgatgaa
aaaccaaatctagatttaaagctaccaggcatcccaatagctgttaaagatttattttgt
acaaaaaaagtcaaaacaaccgctggaagtaaaatattacaaagttttactccaacatat
gagtctacagttacagataatttatggaatgctggagggatattattaggcaagttaaat
tgtgatgaatttgcgatgggttcatcaaatgaaacaagttattatggcaatgtacagaat
ccaattgatgaaaatttagtgcccggaggttcttcgggtggttcggcatctgctgtagct
gcacaattaactcccattactataggtacagataccggtggatctattagacagccagcg
tcatttacaggaactgttggtcttaaacctacttatggtagttgttctcgatatggaatt
gttgccttcgcatcatctctagatcaagcaggtccaatgtctcaaaatgttgaggactgt
gctttgttacatgaggttattagtacttttgataataaagattcaacttctattaatttt
aaaagaaataattatctccaagaacttagcaaaaatatcaaaggaaaaaaaataggaata
cctaaagaatacagagttgaaggaatgccaaaagaaatagaagatttatggcaaaaagga
attgattatattaaagaatgtggggcagaggtcgttgatatttctttaccacatacaagt
tatgctttaccaacttattacattgttgcacctgcagaggcctcatcaaatttagctaga
tatgatggagttaaatacggttttagagccgaaggtaaaaatttaattgatatgtatgaa
aaaactagatctgaaggttttggagcagaggttcaaagacgtattatgattggaacatat
gttttatcttcagggtattatgatgcttattatctcaaagctcaaaaggtaagaaaatta
attaaaaatgattttgacgaagcttataaacaggtagatgcaatattaactccatctaca
ccaagttcagcttttaaaattggtgaaaaaaaagatgatccagtttctatgtatttaaat
gacatatttactgtaccagttaatttagctggattacctggaatatctattccagctggc
catgatgcaaaaggttatccattaggattacaaatcattggtaaagcatttgatgagcaa
aacatattaaacatagcatatgcaatggaagaaaaaattggttttaaaaataatataact
gattggtggattaaatga

DBGET integrated database retrieval system