KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_02200Help
Entry
Asphe3_02200      CDS       T01435                                 

Definition
(GenBank) 3-hexulose-6-phosphate synthase
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00030  Pentose phosphate pathway
apn00680  Methane metabolism
apn01100  Metabolic pathways
apn01120  Microbial metabolism in diverse environments
apn01200  Carbon metabolism
apn01230  Biosynthesis of amino acids
Module
apn_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:apn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Asphe3_02200
  09102 Energy metabolism
   00680 Methane metabolism
    Asphe3_02200
Enzymes [BR:apn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     Asphe3_02200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase Ribul_P_3_epim
Motif
Other DBs
NCBI-ProteinID: ADX71438
UniProt: F0M727
LinkDB All DBs
Position
complement(231142..231765)
Genome map
AA seq 207 aa AA seqDB search
MKLQVAMDVLTVEAALDLAGKVAEYVDIIELGTPLVKNAGLAAVTAVKTAHPDKIVFADM
KTMDAGELEAEIAFAAGADLVSVLGSADDSTIAGAVKAAKAHNKGIVVDLIGVADKVGRA
KEARALGAKFIEFHAGLDEQAKPGYNLDVLLSAGEEARVPFSVAGGVNLSTIGAVQRAGA
EVAVVGGSIYSADDPGVAAKELKAAII
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcaagtagccatggatgtcctcaccgtcgaagcagcactcgacctggccggc
aaggttgccgaatacgtggacatcattgagctgggcacgccgctggtgaagaacgccggc
ctggcagccgtcaccgccgtcaagactgcccacccggacaagatcgtcttcgcggacatg
aagaccatggatgccggcgagctcgaggccgagatcgccttcgcggccggcgcggacctg
gtctccgtgctcggcagcgccgacgactccaccatcgccggcgccgtcaaggccgccaaa
gcccacaacaagggcatcgtggtggacctgatcggtgtggcggacaaggtgggccgcgcc
aaggaagcccgcgccctgggggcaaagttcatcgagttccacgccggcctggacgagcag
gcgaagcccggctacaacctggatgtgctgctgagcgccggtgaggaggcccgcgtgccg
ttctccgtcgcaggtggcgtgaacctttccaccatcggagccgtacagcgcgcaggtgct
gaggtggccgtcgtcgggggttccatttacagcgccgacgaccccggcgtcgccgccaag
gaactgaaggcagcgatcatctag

DBGET integrated database retrieval system