KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_15360Help
Entry
Asphe3_15360      CDS       T01435                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Brite
KEGG Orthology (KO) [BR:apn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:apn01001]
    Asphe3_15360
Enzymes [BR:apn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Asphe3_15360
Protein kinases [BR:apn01001]
 Serine/threonine kinases: Other
  Bacterial family
   Asphe3_15360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kdo Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: ADX72705
UniProt: F0M8X0
LinkDB All DBs
Position
complement(1639935..1642019)
Genome map
AA seq 694 aa AA seqDB search
MSDPLVGTLVDHRYAVRSKLARGGMSTVYLATDQRLERDVALKVLHPHLSADENFLDRLG
REAKAAARLSHPHVVGVLDQGNDGRTAYLVMEYIKGHTLRDLINEKGALPPRLALALVDP
VIEGLGAAHAAGFIHRDVKPENVLISDDGRIKIGDFGLARAVTTSTSTGALIGTVAYLSP
ELVLGKPADARSDIYSVGIMLFEMLTGQQPFSGEVPIQVAYQHVNSTVGPPSALVPGLAA
EVDELVQWCTANDPEKRPVDGNALLQELRHIRTNLTDAELDLHPPAAADGSAAAGPPSQH
RTEVIGRTSHPTTVMPFGRPPAPPYQPSHGQTPAAAGQGQPAAPRRTLTPPGDGDTGEVW
APPPPVRPGKRAQRKADREDERARARAAATPARTLREGSPRRRGVLWIVVLIVAALLATG
AGWFFGMGPGAAATIPSVANKTVAQAQQILADAGFRSTTSDVFDDNVPSGLVVGSEPEAG
REIRKFQPVSLFVSKGPQLFPLPDLAGGTLEEAKNGLNAADMALGTVTEQFNEEVPAGIV
LQQDPAAGTAVRHGTPVALVVSKGPEPIPVPSVVGQDENDAVDAIEAAGLQAEVSREEVF
SRDIPEGAVASQAPATGTLTRGGTVTLTISKGPRMVEVPSFIGKQAGDARKALEALGFQV
RVNNILGGFFGTVRDQDPVDTEVPEGSVITLTVV
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagaccctctggtaggaacgctggttgaccaccggtatgccgtcaggtcaaagctt
gcgcggggcggaatgtccaccgtctacctggccaccgaccagcggctggagcgggacgtg
gccctgaaggtgctgcatccgcacctctcggcggacgagaacttcctggacaggctgggc
cgggaggcgaaggcggccgcaaggttgtcccacccccatgtggtgggggtgttggaccag
ggcaacgacggccgcaccgcgtacctggtgatggagtacatcaaagggcacaccctgcgt
gacctcattaacgagaagggtgccctgcctccacgcctggccctggcactggtcgacccc
gttattgaaggtctgggtgcagcacacgcggcgggcttcatccaccgggacgtgaagccc
gaaaacgtcctgatctccgacgacggccggatcaagatcggagacttcgggctggcacgt
gcggtcacgacttctaccagcaccggggccctgataggcactgtcgcctacctttcaccg
gagctcgtcctggggaaaccggccgacgcgcgcagcgacatctattccgtgggcatcatg
ctgttcgagatgctgacgggacagcagccgttcagcggggaagttcccatccaagtggct
tatcagcacgtcaacagcactgtggggccgccatcagcactggttcccggcctggccgcc
gaagtggatgagctcgtccagtggtgcaccgcgaacgatcctgagaagcggccagtggac
ggcaacgcgctgctccaggaactccgtcatatccggaccaaccttaccgacgccgaactt
gacctccatccgccggcagcagccgacgggtccgcggccgccggtcccccttcccagcac
cggaccgaagtaattggccggaccagccacccaacaacggtgatgccgtttggcaggccg
cccgccccgccctaccagccgtcgcacggccagacgcccgccgccgccggccagggccaa
cccgccgcaccccgtcgcaccctcactccccccggtgacggcgatacaggagaagtctgg
gctcccccgcctcccgtcaggccaggcaagcgtgcccagcgcaaagcggacagggaagac
gaaagggcccgtgcacgagctgccgccactccggcccggaccttgcgcgagggcagtccc
cgccgccgtggggttctgtggatcgtggtcctcatcgttgccgccctgctggcaacgggt
gcaggctggttctttggaatgggtcccggcgccgcggccacaattccctccgtggcaaac
aagacagttgcccaagcccaacagatcctggccgacgccggtttccggtccactaccagc
gatgtctttgacgacaatgttccctcgggcctggtggttggcagcgagccggaagcgggc
agggaaatccgcaagttccagccagtctcgcttttcgtctccaaaggcccccagctcttc
ccgttgccggacctggccggcggcacgctggaggaagcgaagaacggactgaacgcagcc
gacatggcactgggtaccgtcaccgagcagttcaatgaggaagttccggcaggtattgtg
ctgcagcaggacccggcggccggaacggccgtgcggcatggcacacccgtcgccctggtg
gtctccaaaggccccgagcccattcccgttccctcggtagtgggacaggacgaaaacgat
gccgtggatgccatcgaggcggccggactccaggcggaagtttcccgcgaggaagtcttc
agcagggacattccggaaggagccgtggccagccaggccccggccaccggtacgttgacg
cgcggcggcacggtcacgcttaccatctccaaaggaccgcggatggtggaagtccccagc
ttcatcggcaagcaggcaggcgacgcgcggaaggccctggaggcgctgggtttccaggtc
cgggtcaacaacatcctgggcggcttcttcgggaccgtgcgcgaccaggacccggtggac
acagaggtgccggaggggtcggtcataaccctgaccgtggtgtag

DBGET integrated database retrieval system