KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_26910Help
Entry
Asphe3_26910      CDS       T01435                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00220  Arginine biosynthesis
apn00250  Alanine, aspartate and glutamate metabolism
apn00290  Valine, leucine and isoleucine biosynthesis
apn01100  Metabolic pathways
apn01110  Biosynthesis of secondary metabolites
apn01130  Biosynthesis of antibiotics
apn01210  2-Oxocarboxylic acid metabolism
apn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Asphe3_26910
   00290 Valine, leucine and isoleucine biosynthesis
    Asphe3_26910
   00220 Arginine biosynthesis
    Asphe3_26910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:apn01007]
    Asphe3_26910
Enzymes [BR:apn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Asphe3_26910
    2.6.1.66  valine---pyruvate transaminase
     Asphe3_26910
Amino acid related enzymes [BR:apn01007]
 Aminotransferase (transaminase)
  Class I
   Asphe3_26910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR Cys_Met_Meta_PP ComA
Motif
Other DBs
NCBI-ProteinID: ADX73811
UniProt: F0M911
LinkDB All DBs
Position
complement(2871625..2872845)
Genome map
AA seq 406 aa AA seqDB search
MAEFRQSTKLNNVLYDIRGPILQAAQQMEAEGHRILKLNIGNPAPFGFEAPDAILVDMIR
HLPHAQGYSDSRGIFSARTAVSQYYQTRGIQNIHVDDIYLGNGVSELITMSLMALLDDGD
EVLIPTPDYPLWTASVALAGGRPVHYLCDEETGWQPDLEDMEAKITPRTKGIVVINPNNP
TGAVYPEETLRKIVALAEKHGLVVFADEIYEKILYEDAVHINLAGLTGDDVLCLTFSGLS
KAYRVCGYRAGWMAISGPKKDAADYLEGISLLANMRLCANVPAQHAIQTALGGYQSINDL
ILPGGRLLEQRNKAYDMLNAIPGVSTQQARGALYLFPKLDPEVYHIRDDEKFVLDLLREQ
KILVSHGRAFNWVRPDHFRMVTLPNVKDIEEAVGRMGDFLSRYQGN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcagaattcaggcagtccacaaagctcaataacgtcctttatgacatccgtggaccg
atcctccaggccgcacagcagatggaagcggagggtcaccggatcctcaaactgaacatc
ggaaaccccgctccgttcggattcgaagcgccggacgccatcctggtggacatgatccgg
cacctgccgcatgcccagggctacagtgattcccgcggcatcttttctgcccggaccgcc
gtttcgcagtactaccagacccgcgggatccaaaacatccatgtggacgacatctacctg
ggcaacggcgtcagtgaactcatcaccatgtccctgatggcactccttgacgacggcgat
gaagtcctgatccccaccccggactacccgctgtggaccgcttccgtggcgctggccggg
ggcaggcccgtccactacctctgcgatgaggagacgggctggcagccggacctggaggac
atggaagccaagatcacgccgcgcaccaagggcatcgtggtgatcaaccccaacaatccc
accggagcggtgtatcccgaagagacgctgcggaagattgtggcgctggcggagaagcac
ggcctggtggtcttcgccgacgagatctacgagaagatcctgtacgaggacgccgttcac
atcaacctggccggactcaccggcgacgacgtcctgtgcctgaccttcagcggactgtcc
aaggcgtaccgggtgtgcggctaccgcgccggctggatggccatctccggccccaaaaag
gacgcggcggactaccttgaagggatcagcctgctggccaacatgcgcctgtgcgcgaat
gtcccggcccagcatgccatccagaccgcccttggcggataccagagcatcaacgacctg
atcctgcccggcggacgcctgctggaacagcgcaacaaggcctacgacatgctcaacgcg
atcccgggcgtcagtacgcagcaggccaggggagccctgtatctcttccccaagctggac
ccggaggtctaccacatccgcgatgacgagaagttcgtcctggacctgcttcgggagcaa
aagatcctggtctcgcacggccgggcgttcaactgggtccgcccggaccacttccggatg
gtgaccctgcccaacgtcaaggacattgaagaggcagtgggccggatgggggacttcctc
agcaggtaccaggggaactag

DBGET integrated database retrieval system