KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_27180Help
Entry
Asphe3_27180      CDS       T01435                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00564  Glycerophospholipid metabolism
apn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Asphe3_27180
Enzymes [BR:apn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Asphe3_27180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored DnaG_DnaB_bind Pyr_redox_2 NAD_binding_8 Pyr_redox SRP_SPB
Motif
Other DBs
NCBI-ProteinID: ADX73837
UniProt: F0M937
LinkDB All DBs
Position
complement(2898430..2900169)
Genome map
AA seq 579 aa AA seqDB search
MKSVPENSGALGPEAREASIQRLRATADPGQELDILIVGGGIVGAGAALDAVTRGLDVGI
VEASDWAAGTSSRSSKLIHGGLRYLEMLDFALVKEALQERGLLLSELAPHLARPVPFLYP
LTKPFIERPYVGAGIALYDAMSVSSGHSRGVPFHKHLTRRGTLRAAPSLKNDAFVGSIRY
YDGQVDDAKYVANLVRTAAYYGAHAVNQMKVVDFLREGERVVGAKVVNHEDGTEFNIRAK
QVINATGVWTDETQAMVTERGQLKVRASKGIHLVVPRDRFQSTVGLILRTEKSVLFVIPW
GRHWIIGTTDTDWHLDKAHPAASSKDIDYILEHVNKVLKRPLTREDVEGVYAGLRPLLAG
ENDSTAKLSREHVVAHPVPGLVVVAGGKWTTYRVMAKDAVDEATRTMDERVPPSCTETIP
LLGANGYRAAWNRRARTAEEAGVHVARVEHLLNRYGSMTSEVLALIQENPELAEPLPGAD
DYLQAEAVYAATHEGARHVHDVLTRRTRISIEAWDRGVSAVPVVAKLMGDVLGWSDAQRE
NEVRHYIARVEAERLSQQQPDDESADAARLGVEDIVPLR
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtgttcctgaaaacagcggggcccttggcccggaagccagggaagcatccatc
cagcggctgcgcgccacggcggaccccggccaggagcttgacatcctcatcgtcggcggc
ggcatcgtgggtgccggggcagcccttgacgcggtcacccggggactggacgtgggcatc
gtcgaggccagcgactgggcggcaggcacctcctcacggtcctccaagctcatccacggc
ggcctgcgctacctggagatgctcgacttcgcgctggtcaaggaagccctgcaggagcgc
ggtttgctgctctccgagctggcaccccacctggcccggccggttcccttcctgtacccg
ctgaccaagcccttcatcgaacgcccctatgttggcgcaggcatcgccctgtatgacgcc
atgtccgtttccagcgggcacagcaggggagtgccgttccacaagcacctcacccgccgc
ggtaccctgcgggccgcccccagcctgaagaacgacgccttcgtgggctccatccgctac
tacgacggccaggtggatgacgccaagtatgtggccaacctggtccggactgccgcctac
tacggcgcccacgccgtcaaccagatgaaggtggtggatttcctccgcgagggtgagcgg
gtggtcggcgcaaaggtggtcaaccacgaggacgggactgaattcaacatccgcgccaag
caggtcatcaacgccaccggcgtgtggacggacgagacccaggccatggtcaccgagcgc
ggccagctgaaggtccgtgcgtccaagggcatccacctggtggtgccgagggaccgcttc
cagtccaccgtgggactgatcctgcgcaccgagaagtcggtgctgttcgtgattccctgg
ggccggcactggatcatcggcacaacggacaccgactggcacctggacaaggcgcacccc
gcggcctccagcaaggacatcgactacatcctggaacacgtcaacaaagtcctcaagcgg
ccgctgacccgcgaggacgtggagggtgtctacgccggtttgcggccactgctcgccggg
gaaaatgactccacggccaagctgtcccgcgaacatgtggtggcccatcctgtccccggc
ctggtggtggtggccggcgggaaatggaccacctaccgggtgatggccaaagacgcggtg
gatgaggcaacccgcaccatggatgagcgcgtcccgcccagctgcacggagaccatcccg
ctgctgggcgcaaacgggtaccgggctgcctggaaccgccgcgcccggactgcggaggaa
gccggcgtgcacgtcgccagggtggagcacctcctcaaccggtatggctccatgacctcc
gaggtgcttgcactcatccaggagaatccggagctggccgagccgctgcccggcgcggac
gactacctccaggccgaggccgtctacgccgccacgcatgaaggcgcccggcatgtccat
gacgtcctgacccgcaggacacgcatttccatcgaggcctgggaccgcggcgtgtccgcc
gtcccggttgtcgctaaactaatgggtgacgttcttggctggagtgacgcccagcgtgaa
aacgaggtccggcactacattgccagggtggaggcggaacgcctcagccaacaacagccg
gacgacgaatccgcagacgccgcccgcctgggtgtggaggacatcgtgcccttgcgctga

DBGET integrated database retrieval system