KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_33010Help
Entry
Asphe3_33010      CDS       T01435                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:apn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Asphe3_33010
Enzymes [BR:apn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Asphe3_33010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_14 DUF4434 Glyco_hydro_2_C Glyco_hydro_35 DUF4886 DUF1440 Radical_SAM
Motif
Other DBs
NCBI-ProteinID: ADX74408
UniProt: F0M3D3
LinkDB All DBs
Position
3506305..3508356
Genome map
AA seq 683 aa AA seqDB search
MSPSRTPVKQLSGTGNFVYGCDYNPEQWERSVWEEDVRLMKRAGVNLVAVNIFGWAEVEG
SPGIYSFERLDEILELLHANGIGVNLGTGTSSTPAWLTTLHPEILPRSASGVLAWPGGRQ
AWCPSSPHYREHALRLVRETVRRYGAHPAVRLWHVSNELGCHNALCYCDVSAAAFRGWLE
ARYSTLDALNKAWGTTFWSQRYSAWEQILPPRTTASTNNPTQVLDFHRFSSDELLGYYQA
EADILRQHSSIPVTTNFMVTAHIRNLDYWSWAPRMDVIANDHYLDHRLAAPGTELAFAAD
TTRGLAQGQPWLLMEHSTSAVNWQPRNIAKEPGEMLRNSLAHLARGADGLCFFQWRASVQ
GSEKFHSAMLPHAGTDSRIWREVLELGGILEKLAEVAGTTVTAEAALVFSWEAWWAYDQE
SHPSSDVRYLDQVHAMYKALWDAGITVDIVAPGASLSGYKLAVVPGLYLVREREAAVLAD
YVRKGGTAVVTYFSGIVDENETVFTGGYPGAFRDLLGTRSEEFYPLPPGRTLALDNGSTA
SLWTEAARLEGAEAKVSFSEGHLAGSPAVTRNGYGPGSAWYIGTVLDPAGLRDIVTEAAS
DAGITVLESPEGLEVVVRSGVNGSYTFLINHSQDEHKFAAHGRELIVGEDVSNAVVIPAG
AVRVVRTSNPTPPTGPSTGQKDK
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
ttgagtcccagcagaacgcctgtcaagcaactgtccggaaccgggaactttgtgtatggc
tgcgattacaacccggaacagtgggagcggtccgtctgggaggaagacgtcaggctgatg
aagcgcgcaggcgtcaacctcgtggccgtcaacatctttggctgggcggaagtcgagggc
tcccccggaatctactcattcgagcggctggacgagattcttgaactgctccacgccaac
ggaatcggggtcaacctgggcaccggcacatcatccacgcccgcatggctcaccacgctg
catccggagatccttccccggtcggcgtcaggagtgctggcctggcccggtggacgccag
gcctggtgccccagttcgccgcactaccgggaacacgccctgaggctggtgcgggagacc
gtccgccgctatggcgcccaccccgccgtccggctgtggcacgtctccaatgaactcggc
tgccacaacgccctgtgctactgcgacgtgtccgccgcggcgttccgcggttggctcgag
gcgcggtacagcaccctggatgcactcaacaaagcctggggcaccacattctggtcccag
cggtactccgcctgggagcagatcctgccgccccggaccaccgcctccaccaacaacccc
acccaggtcctcgacttccaccgtttcagttcggacgaactgctcggctactaccaggcc
gaagcggacatcctccggcagcacagcagcattccggtcaccaccaacttcatggtcacg
gcgcatatccgcaacctggattactggtcctgggcgccgcggatggatgtgatcgccaat
gaccactacctggaccaccgccttgctgctcccggcacggaactggcctttgccgccgac
accacccgcgggctggcccagggccagccctggctgctgatggagcactccacctcggcc
gtgaactggcagccccgaaacatcgccaaggaaccgggtgagatgctgcgcaactcgctc
gcccacctggcccggggagcggacggcctgtgcttcttccagtggcgcgcgtccgtccag
ggcagcgagaagttccattcagcgatgctgccccatgccggaaccgactcccggatctgg
cgggaggtcctggaactgggcggcatcctcgagaaactcgccgaggtcgcgggaaccact
gtcacggcagaggcggccctggtgttcagctgggaagcctggtgggcctacgaccaggag
tcccacccttcttctgacgtgcggtacctcgaccaggtccacgccatgtacaaggcactc
tgggacgccggcatcacggtggacatcgttgccccgggcgccagtctctccggttacaaa
ctggcggtcgtccccggcctttatctcgtccgggaacgcgaggccgcggtactggccgat
tacgtcaggaaggggggcaccgccgtcgtcacgtatttcagcggcatcgtggatgaaaac
gaaacggtgttcaccggaggttacccgggggcgttccgcgacctgctgggcacccgctcc
gaggagttctaccccctgccgccgggacggaccctggcactggacaacgggtccaccgcc
tcgctgtggaccgaggccgcgcggctcgaaggtgccgaagccaaggtgtcgttcagcgaa
gggcacctggccgggtcgcccgcagtaacccggaacggctacggacccgggagcgcctgg
tacatcggcaccgtactcgacccggcagggctgcgtgacattgtcaccgaagccgccagt
gatgccggaatcaccgtgctggaatccccggaaggcctggaagttgttgtccgctcaggt
gtgaatggcagctacaccttccttattaaccactcacaggacgagcacaagttcgcggcg
catggccgggaactcattgtgggcgaggacgtctccaacgccgtcgtcattcctgcaggc
gcggttcgcgttgtccgcacctccaatccaacacccccaaccggcccaagcaccggccaa
aaggataaatga

DBGET integrated database retrieval system