KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_38910Help
Entry
Asphe3_38910      CDS       T01435                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
apn  Pseudarthrobacter phenanthrenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ADX74979
UniProt: F0M9C5
LinkDB All DBs
Position
complement(4146806..4147882)
Genome map
AA seq 358 aa AA seqDB search
MELPVMPPVPPMLAKAVSGIPEGDLSYEPKWDGFRSIIFRDGDDVEIGSRNEKPMTRYFP
ELVEALKENLPPRCVVDGEIVLIGPSGDRLDFDALQQRIHPAASRVRLLAEQTPASFVAF
DLLALGDDSYMDRPFTERRAALEKALAASKAPVHLTAATTDKDTAQRWFEQFEGAGLDGV
VAKRLEGRYEPDKRVMFKTKHERTADCVVAGYRLHKSGPDAIGSLLLGLYKDDGGLASVG
VIGAFPMKRRRELYEQLQQLVTDFDNHPWAWAKQEEGERTPRNAEGSRWSAGKDLSFVPL
RPELVVEVRYDHMEGDRFRHTAQFNRWRPDRDPESCTYAQLEEPVSFDLVSVLETGRP
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggaacttcccgtgatgccgcccgtcccgcccatgctcgccaaggccgtcagcggcatc
cccgaaggcgacctcagctatgagccgaagtgggacgggttccggtccatcatcttccgc
gacggcgatgacgtggagatcggcagccgcaacgaaaagccgatgacgcgctactttccc
gagctggtggaggcgcttaaggaaaacctgccgccgcggtgcgtggtggacggtgaaatc
gtcctgatcgggccttccggcgaccggctggatttcgacgccctccagcagcgcatccat
ccggcagcgagcagggtcaggctgctggcagagcagacgcccgcctctttcgtggcgttc
gacctgctggcccttggcgatgacagctatatggacaggcccttcacggagcggcgcgca
gccctggagaaggcgctcgcggcgagcaaggcgccggtgcatctcacggccgccacaaca
gacaaggacactgcgcaacggtggttcgagcagttcgagggcgccggcctggacggggtg
gtggccaaacggctcgagggccggtacgagccggacaagcgggtcatgttcaagacgaag
cacgagcggactgcggactgcgtggtggcaggctaccggctgcacaagagcgggcccgac
gccatcgggtcgctgctgctgggcctgtacaaggacgacggcggcctggccagcgtgggc
gtgatcggcgcgttccccatgaagcgccgccgggaactgtatgaacagctccagcagctg
gtgaccgattttgataaccatccgtgggcctgggccaagcaggaggaaggcgagcggacc
ccgcggaacgccgaaggcagccgctggagcgccggcaaggacctgtccttcgtgccgctg
cgtccggaactggtggtggaggtccggtacgaccatatggagggggaccggttccggcac
accgcccagttcaaccgctggcggccggaccgtgatcccgaatcgtgcacctacgcccag
ctggaggagccggtcagcttcgacctggtgtcggtactggagaccggccggccctag

DBGET integrated database retrieval system