KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_41980Help
Entry
Asphe3_41980      CDS       T01435                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
apn  Pseudarthrobacter phenanthrenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase DUF4219
Motif
Other DBs
NCBI-ProteinID: ADX75263
UniProt: F0MCK7
LinkDB All DBs
Position
pASPHE302:7532..8551
Genome map
AA seq 339 aa AA seqDB search
MAESLPPALQPPVAVALAKLVKTFPGRNALPGGLSAEPKWDGFRTTAFNDGGMVTLWSRQ
GKELTRILPDATAALEEQLPPGVVLDGEAVIWNRGRLDFDALQRRMVTSRAALPAVAIEL
PASFVAFDVLAVAGQDTRAVPFSGRRQLLEELARDWAAPLHLSPITTDVDLAKTWLRDLP
ATGIEGLVFKGGAQPYEAARIWSKLKHKDVWDVVCAAVIGPVSQPQAIIAGLPIDGELKI
VGRSTVLSTKVGRELGRYLQAAGHGHPWPEEISESSLNRFSRDKGPARLTLVEPFVVEIS
ADVAWSGTSFRHPVGYRRSRPELDPADVRVPPELNNRHR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggccgagtcccttccgccggcactgcagccaccagtcgcggtcgccctggcgaaactc
gtcaagaccttccccggccgcaacgcactgcccgggggcctaagcgcagaacccaaatgg
gacggtttccgcactactgcctttaatgacggtggcatggtgacgctgtggtccagacag
ggcaaggaacttacccgaatcctgccggacgcaacggcggctctcgaagagcagttgcct
cccggtgtggtcctggacggtgaagccgtcatttggaaccggggccggctggatttcgat
gcgctgcagcggcgcatggtcacctccagggccgcgcttccggcggtggccattgagctg
cccgcttcgttcgtggccttcgatgtcctggccgtcgccgggcaggacacccgggctgtt
ccgtttagcgggcgacggcagctgctcgaggagctcgcccgggactgggcggcgccgttg
cacctctcccccatcaccacggacgtggacttggccaagacctggctccgggatcttccc
gcgaccggaatcgaaggtttggtgttcaagggtggcgcccagccctacgaagcagccagg
atctggtcgaagctcaagcacaaagatgtttgggacgtggtgtgtgccgcagtgatcggg
ccagtctcccagccgcaggccatcatcgccggcctgcccatagacggcgaactgaagatt
gtcggccggtccacggtcctgtccactaaggtcgggcgcgaactgggccgatacctccaa
gcagccgggcatgggcatccctggccggaagagatcagcgagtcctccctgaacagattc
agtagggacaaaggccccgcgcggttgaccttggtcgaaccgttcgtagtcgaaatctcg
gccgacgtcgcttggtccggcacgtccttccggcatcctgtcggctaccggcgctccaga
ccggagttggaccctgcagacgtcagggtcccccctgaattgaacaacaggcaccgatga

DBGET integrated database retrieval system