KEGG   Archaeoglobus profundus: Arcpr_0100Help
Entry
Arcpr_0100        CDS       T01152                                 

Definition
(GenBank) phosphate ABC transporter, ATPase subunit
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
apo  Archaeoglobus profundus
Pathway
apo02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:apo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Arcpr_0100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:apo02000]
    Arcpr_0100
Enzymes [BR:apo01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     Arcpr_0100
Transporters [BR:apo02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    Arcpr_0100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_22 AAA_15 AAA_16 PRK RsgA_GTPase AAA_29 AAA_24 Rad17 ATPase_2 TniB AAA_23 NACHT AAA_33 AAA_18 AAA NB-ARC AAA_30 AAA_14 AAA_28 AAA_5 RNA_helicase AAA_7 AAA_25
Motif
Other DBs
NCBI-ProteinID: ADB57172
UniProt: D2RFU7
LinkDB All DBs
Position
87057..87809
Genome map
AA seq 250 aa AA seqDB search
MNAIETVNLRVWYGNNEVIKGVDLLIPQNVCFAIMGPSGCGKSTLLRTFNRLLELNEIAR
VEGDVKLFGRSVYKMNAVEVRRRVGMVFQIPNPFPHMSIYDNVALGVKYNKLVKSKKELD
EVVEWALKKAALWDEVKDRLKDKASQLSGGQMQRLCIARALALKPDVLLMDEPTANLDPV
SASKVEELIYELKKELTIVIVTHSPAQASRVSDYVAFLYMGKLIEIGKTEEVFENPKNEL
TERYLTGRMG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcaatcgaaaccgtgaatcttagagtttggtacggtaacaacgaggtaatcaag
ggtgtggacttattgatacctcaaaacgtctgctttgcgataatgggtccttctggatgt
ggaaaatcaactctcctgagaaccttcaacaggttgctcgaacttaacgaaatagctaga
gttgaaggggatgtgaaactctttgggagaagcgtatacaagatgaatgctgttgaagtt
agaaggagggttgggatggtctttcaaattccgaacccctttcctcacatgagcatatac
gacaacgtagccttgggcgttaaatacaacaagctcgtcaaatcgaaaaaggagcttgat
gaagtggtggaatgggcattaaaaaaagctgcactttgggatgaggttaaggataggttg
aaggacaaggcatcacagctgagcggtggacagatgcagaggctttgcattgcaagggct
ttagctttaaagcctgacgtgttactgatggacgaacccacagcaaatctcgatcccgtc
agtgcaagtaaagttgaagagcttatttacgagcttaaaaaggagttaacgatagtaatc
gttactcactcaccagctcaggcatcaagggttagtgattatgtcgcctttctatacatg
ggaaagctgatagagattggtaaaactgaggaggtcttcgaaaatccgaagaacgagctg
actgagaggtatttgaccggtagaatggggtga

DBGET integrated database retrieval system