KEGG   Archaeoglobus profundus: Arcpr_1305Help
Entry
Arcpr_1305        CDS       T01152                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
apo  Archaeoglobus profundus
Brite
KEGG Orthology (KO) [BR:apo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Arcpr_1305
Enzymes [BR:apo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Arcpr_1305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M DUF5009
Motif
Other DBs
NCBI-ProteinID: ADB58356
UniProt: D2RE12
LinkDB All DBs
Position
1117467..1118615
Genome map
AA seq 382 aa AA seqDB search
MKDIASAIGVSAPALRELFRRDILRKAFISHPFFSDVLEAYKLDRKFGGFEEGTLIAKTV
EGVEIVRGFPKIKRALTLYPTIKKHFKGDVAIEEKMNGYNVRIVKFGEKLYAITRGGFIC
PYTTEKVRLIFDKSFFKDHPNLMLCCEAVGEESPYVPSSIYGERLDFYVFDIRDKSTNEA
LSIKEKERICENYGFNMATIFDVVSSKIAHEVVRDVIEKIGKEGREGVVIKDVEMKEPPI
KYTTSQANCSDLSYGFRYFGEYGKDFLFSRLIREGFQSWEFCESEENMYERALRIGKAIL
FSMVESIRNVKDRGKVYENMRLRFYDLEVFELFKEHVRRMGVSAKFSDPIQDEDGSYVVH
YYKYMKSTTDIVKHILEGNLWS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatattgctagtgccattggcgtttccgctccagctttaagggagctcttcaga
agggacatcttgagaaaagctttcataagtcatccctttttttcagacgttttggaggct
tacaagctcgacagaaagtttggtggttttgaagagggaacgttgatagctaagacagtt
gaaggtgttgagatcgtaagggggtttcccaagataaagagggccttaacgctgtatcca
accattaaaaagcacttcaaaggcgatgttgcgatagaggagaagatgaacgggtacaac
gtaaggattgtcaaattcggagagaaactttatgcaataaccagaggaggcttcatatgc
ccctacactaccgagaaagttaggttaatttttgataagtccttttttaaagatcatccg
aatttgatgctctgctgtgaagctgtgggggaggaatcaccgtacgttccaagctcaatt
tacggcgaaagacttgacttttacgttttcgatataagagataagagtacgaacgaagcc
ctatccatcaaagagaaggagaggatttgcgagaattacggctttaatatggcgacaata
tttgacgttgttagttcaaagatcgctcacgaagtcgttagggatgtaatagagaagata
gggaaggagggtagggagggagtagttataaaggacgttgagatgaaggaacctcctata
aagtatactacgagtcaagccaactgttccgatctcagctacggctttagatactttggt
gagtacggtaaggattttctgttttcgaggttgataagggagggttttcagagttgggag
ttctgcgagagtgaagagaatatgtacgaaagggctttgagaataggaaaagcaattctc
ttttccatggttgaaagtataaggaatgttaaagatagaggaaaagtgtacgagaatatg
aggttgagattttacgatctcgaagttttcgagctctttaaggagcacgtgagaaggatg
ggtgtatctgcaaagttttcagatccaattcaagatgaagacggtagctacgtcgttcac
tattataagtacatgaagtccactacggacatcgttaaacatatattggaaggtaacctc
tggtcgtaa

DBGET integrated database retrieval system