KEGG   Archaeoglobus profundus: Arcpr_1309Help
Entry
Arcpr_1309        CDS       T01152                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, C subunit
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
apo  Archaeoglobus profundus
Pathway
apo00970  Aminoacyl-tRNA biosynthesis
apo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Arcpr_1309
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:apo03029]
    Arcpr_1309
Enzymes [BR:apo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Arcpr_1309
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Arcpr_1309
Mitochondrial biogenesis [BR:apo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Arcpr_1309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln DUF896
Motif
Other DBs
NCBI-ProteinID: ADB58358
UniProt: D2RE14
LinkDB All DBs
Position
1121678..1121962
Genome map
AA seq 94 aa AA seqDB search
MITEEEVLHVANLAKIELKPEDVKKFKEEFSKILEYFSILDEVGEDVEPTYHVLPLKNVF
REDVPKEPLPRELVLMNAKHVEDGYFKGPKIMED
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgataaccgaggaggaggttcttcacgttgcaaatcttgccaagatcgaattgaaacct
gaggacgtgaaaaagtttaaagaagagttttcaaagattttggaatacttcagcatactc
gacgaagttggtgaggatgttgaaccgacttatcacgtcctaccgctcaaaaacgttttt
agagaagacgttccaaaggaacctctaccgagagaactcgttttgatgaatgcaaagcat
gtggaggatggatacttcaaagggccgaagataatggaggattga

DBGET integrated database retrieval system