KEGG   Archaeoglobus profundus: Arcpr_1634Help
Entry
Arcpr_1634        CDS       T01152                                 

Definition
(GenBank) ribulose bisphosphate carboxylase, type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
apo  Archaeoglobus profundus
Pathway
apo00630  Glyoxylate and dicarboxylate metabolism
apo01100  Metabolic pathways
apo01120  Microbial metabolism in diverse environments
apo01200  Carbon metabolism
Module
apo_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:apo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Arcpr_1634
Enzymes [BR:apo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Arcpr_1634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ADB58680
UniProt: D2REY6
LinkDB All DBs
Position
complement(1390823..1392166)
Genome map
AA seq 447 aa AA seqDB search
MLHRTRVMPDFEMYFEYVDKSYEPSERDLIAVFRVKPSEGFKIEDVAGAIASESSTGTWT
TLYDWCDKDRIKKLSAKAYEFIDLEDGSWIVKIAYPVELFERGSITCLLASIAGNIFGMK
RVAGLRLEDVYLPKEFLKYFEGPNFGKDVRKIFKVYDRPIVGTVPKPKVGYTPDEVEKLA
YELLSGGMDYIKDDENLTSQDFCKFEERAKAIMKAIDKAESDTGEKKVWFANITGDVKEM
EKRMKIVADYGNPYVMIDVVIAGWSVLKYMRELANDYGLAIHAHRAMHSAFTRNRYHGIS
MFVLAKLYRVIGVDQLHIGTAGYGKLEGGMWEVVQYAKILRESSYVPDEKDIFHIKQEFH
HIKPAMPVSSGGLHPGNVAGVIDALGEDIIIQVGGGVMGHPDGPKAGAKAVRQALEAIKL
GIPLDEYAKDHKELAKALEKWGYVKPV
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgttgcataggacaagagttatgccagatttcgaaatgtatttcgaatacgtagacaaa
agctatgagccgagcgaaagagatttgattgccgtttttagagttaaaccatcagagggt
tttaaaatagaggatgttgctggtgcaatagcatctgaaagtagtacgggaacttggaca
actctctacgattggtgtgataaagatagaataaaaaagttgagtgcaaaggcttacgaa
tttatagatttagaggatggatcttggattgttaaaatagcctatcccgtagaacttttt
gaaagggggagtataacatgcttactagcctcgatagcgggaaacatatttggaatgaaa
agggtagccggtttgaggcttgaagacgtctacctaccaaaagagttcttaaaatatttt
gaaggacctaactttggtaaagatgttagaaaaatattcaaagtttacgatagaccaatc
gtaggaacagttccgaaacctaaagtcggatacacaccagatgaggttgaaaagttggct
tacgagcttctcagcggtggaatggattacatcaaggacgacgagaatttaacaagtcag
gacttctgcaagtttgaagaaagagctaaagcgataatgaaagccatagataaagctgag
agtgataccggagagaaaaaagtctggtttgcaaacatcactggagacgttaaagaaatg
gagaagagaatgaaaatagttgctgattacggtaacccctatgtcatgattgatgttgtc
atagctggatggagcgttcttaaatacatgagagagctggcaaacgactacggattagcc
attcacgctcatagagcgatgcattcagcttttacgagaaacagataccacggaatatcg
atgttcgttttagctaagctctacagagtgattggtgtcgatcaacttcacataggaact
gcaggttacggaaagcttgaaggggggatgtgggaggtcgttcagtatgcaaagatactc
agggaaagcagttacgtgccagatgagaaggacatcttccacataaagcaggagttccac
cacataaaaccagcaatgccagtttcatctggaggtttacatccgggtaacgtagctgga
gttatagatgccctaggagaggacataatcattcaggttggtggtggtgttatgggtcat
ccagatggacccaaggcgggagctaaggctgtaaggcaggctctagaggccataaagctc
ggaattccactcgatgagtatgcgaaggatcataaagaattggcgaaagctttggaaaag
tggggttacgtgaagccagtttaa

DBGET integrated database retrieval system