KEGG   Acetobacter pomorum: CPF11_01610Help
Entry
CPF11_01610       CDS       T05180                                 

Gene name
cysC
Definition
(GenBank) adenylyl-sulfate kinase
  KO
K00955  bifunctional enzyme CysN/CysC [EC:2.7.7.4 2.7.1.25]
Organism
apom  Acetobacter pomorum
Pathway
apom00230  Purine metabolism
apom00261  Monobactam biosynthesis
apom00450  Selenocompound metabolism
apom00920  Sulfur metabolism
apom01100  Metabolic pathways
apom01120  Microbial metabolism in diverse environments
apom01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:apom00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    CPF11_01610 (cysC)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CPF11_01610 (cysC)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CPF11_01610 (cysC)
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    CPF11_01610 (cysC)
Enzymes [BR:apom01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.25  adenylyl-sulfate kinase
     CPF11_01610 (cysC)
   2.7.7  Nucleotidyltransferases
    2.7.7.4  sulfate adenylyltransferase
     CPF11_01610 (cysC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APS_kinase GTP_EFTU MMR_HSR1 AAA_33 RsgA_GTPase cobW AAA_22 AAA_29 ABC_tran AAA_16 GTP_EFTU_D2 AAA_18 PduV-EutP FeoB_N Zeta_toxin KTI12 MeaB AAA_30 SRP54 DUF815 Dynamin_N AAA_24 PEPCK_ATP
Motif
Other DBs
NCBI-ProteinID: ATI11270
LinkDB All DBs
Position
complement(332691..334571)
Genome map
AA seq 626 aa AA seqDB search
MSEKIYSSQDAATPIVIVGHVDHGKSTLIGRLLHDTDSLQDGKVAQIIESSKKRGLKIEW
SFLLDSLQIERDQGVTVDSTRIPFRLGQREFVIVDAPGHRQFLRNMITGAADAEAAVLVV
DAQEGAREQTRRHAMLLHLIGIRHVIVLLNKVDLLDFDQAKVEAVEKSVTELLNKLGLEA
ALFVPASARDGDNIASRSERSPWYKGPTLTEALASVPSPASRSELALRLPVQDVYRFDNT
RYVAGRVERGRVRVGDTVIIGTQKTPARIASIESWHTAPHVSASAGQSIAVTLEPDVIPD
RGDLLHHADARPMEASRVRVRLFWLRQEPLRVGEHFRLRLATAEHAVTVTAIDKVVDLDD
LTEHPGTEVPPEGFAEIVLSAAENIQFDPFTPGTTDGRGVLVDRQQRIVGGAPIIGPANI
ADGEKVIHPSASTVTVQDRERAKGHKGSVFWLTGLSGSGKSTLARAAETRLFADGVDVTV
LDGDTLRAGLCKDLGFSEADRTENVRRAAEVARLLRDAGQVVIVALISPLRSDRDLARQI
IGDGFEEVFVDADLGTCEQRDPKGLYAAARAGKISGFTGIDAPYEAPAKPALHLITGKDS
VEAATKTLVTFVEDAVRNKAGARAQS
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaaaatttattcatctcaggatgccgccacgccaatcgtgattgtggggcat
gttgaccacggcaaatccacccttatcgggcgcttgctgcacgatacggacagccttcag
gatggcaaggttgcccagattattgaatcatccaaaaagcgcggcctgaagattgagtgg
agcttcctgctggactcccttcagattgaacgcgatcagggcgtaactgttgattccacc
cgtattccgttccgcttggggcagcgcgaatttgtgattgtggatgcaccaggacaccgc
cagttcctacgcaacatgattacaggtgccgccgatgcagaagccgcagtactggtggtg
gatgcacaggaaggtgcgcgtgaacagacacgccgccacgccatgctgctgcaccttatc
ggtattcgccacgttattgtgctgctgaacaaagtggatctgcttgatttcgatcaggct
aaggttgaggccgtcgaaaaatccgtaacggaactgctgaacaagttggggctggaagcg
gccctgttcgttccggcttctgcgcgtgatggtgataacattgccagccgctcagagcgc
tctccgtggtataaaggccccacgctaacagaagctctggccagcgtgccctctcccgct
tcccgctccgagctggcgcttcgtctgcccgtgcaggacgtgtaccgttttgataacacc
cgttatgtggcaggccgtgttgagcgtggccgggtgcgcgtgggcgataccgttattatc
ggcacacagaaaacccctgcccgcattgcatcgattgaaagctggcatacagcgccgcat
gtttctgcttctgctgggcagtccatcgcagtcacgctggaaccagacgtgattcctgat
cgtggagatctgctgcatcatgcggatgcacgtccaatggaagcttcccgcgtgcgggtg
cgtctgttctggttgcgtcaggagccgctgcgtgtgggtgagcatttccgcctgcgtttg
gctacggcagaacacgccgttaccgttaccgccattgataaagtggtggatctggatgat
ctgacagaacaccccggcacggaagttccgcccgaaggctttgcggaaattgtgttgtct
gcggcagaaaacattcagtttgacccgttcacacccggcacaacggatggccgtggtgtg
ttggttgaccgccagcagcgtattgtggggggggcacccattattggcccggccaatatt
gcagatggtgaaaaggttattcatccaagcgccagcaccgttaccgtgcaggatcgtgaa
cgcgctaaaggccataaaggctctgtgttctggctgactggtctgtctggctctggcaaa
agcacgctggcccgtgcggcagaaacccgtctgtttgcagatggtgtggatgtaacagtg
ctggatggtgatacactgcgcgctggtctgtgcaaggatttgggcttctctgaagcagac
cgaaccgaaaacgtacgccgtgctgcggaagtggctcgcctgctgcgtgatgccggtcag
gttgttatcgtggccttgatctctcctctgcgttccgatcgtgatctggcccggcagatt
attggtgatgggtttgaggaagtgtttgtagatgctgatctgggcacctgtgaacagcgt
gaccccaaggggctgtatgccgcagcacgtgcaggaaaaatcagtggctttacgggcatt
gatgccccgtatgaagcccctgccaagcctgccctgcacctgataacaggtaaggatagt
gtagaggctgccacaaaaacgctggtgacttttgtggaagacgccgtgcgtaacaaagcg
ggtgcgcgtgcgcagtcctga

DBGET integrated database retrieval system