KEGG   Acetobacter pomorum: CPF11_03655Help
Entry
CPF11_03655       CDS       T05180                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase subunit E1
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
apom  Acetobacter pomorum
Pathway
apom00020  Citrate cycle (TCA cycle)
apom00310  Lysine degradation
apom00380  Tryptophan metabolism
apom01100  Metabolic pathways
apom01110  Biosynthesis of secondary metabolites
apom01120  Microbial metabolism in diverse environments
apom01130  Biosynthesis of antibiotics
apom01200  Carbon metabolism
Module
apom_M00009  Citrate cycle (TCA cycle, Krebs cycle)
apom_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CPF11_03655 (sucA)
  09105 Amino acid metabolism
   00310 Lysine degradation
    CPF11_03655 (sucA)
   00380 Tryptophan metabolism
    CPF11_03655 (sucA)
Enzymes [BR:apom01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     CPF11_03655 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II
Motif
Other DBs
NCBI-ProteinID: ATI13343
LinkDB All DBs
Position
complement(761773..764646)
Genome map
AA seq 957 aa AA seqDB search
MAVSDVLATALNGANIAYLADLYAQWAKDSKSVDPSFDILFSSLGDDEAAVLKDAVGASW
APRPSIITGDEPAPAPKGKGGPAGGLAAQDSLAIARLIRAYREYGHKEASLDPLGLKVPH
KTEELDPASYGFGEKDLNREVFIGSLLDPLLKGKNTAKVSEVIAALRSVYCESIGAEYMY
ARNHEQREWLRKRLEGDNWRARVTVEEQKVILANLTEAEGFEAFCQKRYVGAKRFGLEGG
EISIPSLHAIIDSCASQGVTSVAIGMAHRGRLNTLVNVVRKPYVAIFNEFAGGSFKPDNV
EGSGDVKYHLGSSTDVDVAGKAVHISLQPNPSHLEAVDPVVCGKVRAIQDDAGDTEKRLS
SLGVIIHGDAAFAGQGIVYETFAMSQLPGYRTGGTIHMVVNNQIGFTTNPECGHSGVYGT
DVAKSIEAPVLHVNGDDAEAVIYVSRLAADYRQAFASDIVLDIICYRRHGHNETDEPVFT
QPVMYKAIAAHDTPHTLYAKHLVKAGVVTDDEVKAQWDAFHAKLDEDYKAAQSYKVNKAD
WLEGGWKGLVAAGHDPERAFPETGVALDALRKIGEAITKVPEGFNLNSKIARQLKAKANM
FSTGEGFDWATGEALGFGSLLLDGHRVRLSGEDCQRGTFSQRHAVWTDQVNQTPFTPLNH
IQDKQAQIEIWNSLLSEYGVLGFEYGYSVRNPQTLVLWEAQFGDFANCAQVIIDQFIASG
ETKWLRMSGLVMLLPHGYEGQGPEHSSARLERYLQLCAENNMFVCNITTPANYFHALRRQ
LKLDYRKPMILMEPKSLLRHKLAVSALADFGPGTRFKPVIGEIDDLGADNKVRRVVICSG
KVYYDLLAERREKGIKDIAILRLEQLYPFPEAALAAELKRYPEADIVWCQEETENGGAWH
FADRRIEAALVAAGHKAGRPQYVGRAAAASPATGLARIHAAEQADLVERALGLKKSG
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttcggacgtactggcaaccgctcttaacggtgccaatatcgcttaccttgcg
gatctgtatgcccagtgggcgaaggattctaaaagtgtagatccgtccttcgatattctg
ttcagctcgctgggcgatgatgaagccgcagtgctgaaggatgccgttggagcctcttgg
gcgccacgcccttccattatcacgggggatgaacccgcacccgctccaaaaggaaaaggt
ggcccggctggtgggttggccgcgcaggatagtctggccattgcccggctgatccgtgcg
tatcgtgaatacggacataaggaagcctcgcttgatccgctgggcctgaaggtgccgcat
aaaaccgaggaactggaccccgcatcatacggttttggtgaaaaagacctaaaccgcgaa
gtgtttattggatcactgcttgatccgttgctcaagggcaagaacacggccaaggtttcc
gaggttattgcggcgctgcgttctgtgtattgcgaaagcattggcgcagaatacatgtat
gcccgtaaccacgaacagcgcgaatggctgcgcaaacggttggaaggtgataactggcgc
gcccgcgtaacggtggaagagcagaaggttatcctagccaacctgaccgaagccgaaggg
tttgaagccttctgccagaaacgctacgtgggtgcgaagcgttttggtttggaaggggga
gaaatctctattccatccctgcatgccattattgattcctgcgccagccagggggtcact
tctgttgctatcggcatggcacatcgtgggcgtttgaacacgctggtgaacgtagtgcgc
aagccttacgtggctatctttaacgaatttgctggtggttccttcaaaccagacaatgtt
gaaggttcgggtgacgttaaataccaccttggctcctccacagatgtggatgtagcaggc
aaggcggtgcatatctccctccagcccaacccttcccatctggaagcggttgatccggtt
gtgtgcggtaaggtgcgcgccattcaggatgatgcgggcgatacggaaaaacgcctgtcc
agccttggcgttatcatccacggtgatgcggcatttgccggacagggcattgtttacgaa
acctttgctatgtcccaactgccgggctaccgcaccggcggcaccatccatatggtggtg
aacaaccagattggctttaccaccaatccggaatgtgggcattcgggcgtttacggcacc
gatgttgcaaaatccattgaagcccccgtgctgcatgtaaacggtgatgatgccgaggcg
gtcatttacgtctcccgccttgctgcggattatcgtcaggcttttgcaagcgacattgtg
ctggatatcatctgctatcgtcgccacgggcataacgaaacggatgagcccgtctttacg
cagccggtgatgtacaaagccattgccgcgcacgatacgccacacacgctttatgcaaaa
caccttgtaaaagcaggcgttgtgacggatgacgaagtgaaggcccagtgggatgccttc
cacgccaagctggatgaagattacaaggctgctcagtcttataaggtcaacaaggcagac
tggctggaaggtggctggaaaggtcttgtggctgccgggcatgatccggaacgcgccttc
cctgaaacaggtgttgcactggatgcgctgcgcaagattggcgaagccattacaaaagtg
ccagaaggcttcaacctgaattccaaaattgcccgccagcttaaggccaaggcaaatatg
ttcagcacgggtgaagggtttgactgggcaactggtgaagctctgggctttggctctctg
ctgctggatggccaccgtgtgcgtctttctggtgaggattgccagcgtggcacgtttagc
cagcgtcatgccgtgtggacggatcaggtcaaccagacaccatttacgccgctaaaccac
attcaggacaagcaggcgcaaatcgaaatctggaactcgcttctttcagaatacggcgtg
cttgggtttgaatacggatattccgtgcgcaacccgcaaacgctggtgctgtgggaagcc
cagtttggtgattttgccaactgtgctcaggtaattatcgatcagtttattgcttcgggg
gaaaccaagtggttgcgtatgtccggtttggtcatgctgctgccgcatggttacgaaggg
caggggccggaacattcttctgcccgtctggaacggtatcttcagctttgcgctgaaaat
aacatgtttgtttgcaacatcaccacgccagcaaactacttccatgctttgcgccgccag
cttaaattggattaccgcaagccgatgatcctgatggaaccgaaatctctgctgcggcac
aaacttgctgtttccgcactggcagattttgggccgggcacacgctttaaacccgttatt
ggcgaaattgatgatctgggtgccgataacaaggtgcgccgcgtggtgatctgctctggc
aaggtctattacgatctgctggccgaacgccgggaaaaaggcattaaggatattgccatc
ctgcgtctggaacaactctaccccttcccggaagcagccctagccgccgaacttaagcgc
tatcctgaagcggacattgtctggtgtcaggaagaaacggaaaacggtggtgcatggcat
tttgcagacaggcggattgaagcagcccttgttgccgcaggccataaggcaggccgcccg
caatatgtgggccgtgcagcagcagccagcccggccaccggccttgcccgtattcatgcg
gcagagcaggcagacttggttgaacgcgcattggggctgaaaaagtctggctga

DBGET integrated database retrieval system