KEGG   Acetobacter pomorum: CPF11_08085Help
Entry
CPF11_08085       CDS       T05180                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
apom  Acetobacter pomorum
Pathway
apom00250  Alanine, aspartate and glutamate metabolism
apom00280  Valine, leucine and isoleucine degradation
apom00410  beta-Alanine metabolism
apom00640  Propanoate metabolism
apom00650  Butanoate metabolism
apom01100  Metabolic pathways
apom01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apom00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CPF11_08085 (gabT)
   00650 Butanoate metabolism
    CPF11_08085 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CPF11_08085 (gabT)
   00280 Valine, leucine and isoleucine degradation
    CPF11_08085 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CPF11_08085 (gabT)
Enzymes [BR:apom01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CPF11_08085 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CPF11_08085 (gabT)
Amino acid related enzymes [BR:apom01007]
 Aminotransferase (transaminase)
  Class III
   CPF11_08085 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ATI12413
LinkDB All DBs
Position
complement(1705989..1707275)
Genome map
AA seq 428 aa AA seqDB search
MATNKDLLNRRTHAVPRGVATSTPVFADRAENAELWDVEGKRYVDFAGGIAVLNVGHRHP
KVMDAVKKQLDRFTHTAFQVSAYEAYIELAEKLNARAPFSGDAKTIFFTTGGEATENAVK
IARAATGRNGVIAFCGGFHGRTLLASALTGKVLPYKAPFGTLPGEVYHIPFPDNHDITVE
DSLKMLHFLFAADISPNNVAAIIIEPVQGEGGFRVAPTALLKQLRAICDQHGIKLIADEV
QSGFARTGKLFGIEHSGVEPDLVCIAKSLAGGFPLSGVIGRAELMDSVPPGGLGGTYAGA
PLGCAAGLAVLDIIEEEKLLDRANNMGERLKARIASWHKRTDMLPISMPRGLGAMVAFDI
LERHAGVEQRKGFGSKLCARACEKGLILLACGVQGATIRILTPLTASDELVDEGLDIIEQ
ILLEDAKA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccacgaataaagaccttctgaaccgccgcacccatgctgtgccacgcggtgttgcc
acctccacccccgtttttgcagatcgcgcagaaaatgctgaactatgggatgtggaaggc
aaacgctatgttgattttgcaggcggcattgccgttctgaacgttggccaccgccaccca
aaagtgatggatgctgttaaaaagcagctagatcgctttacccacacagcttttcaggtt
tctgcttacgaagcctatattgagctggccgaaaagctgaacgcccgcgccccattttct
ggcgatgccaaaaccattttcttcaccacgggtggagaagcaacagaaaacgccgtaaaa
attgctcgcgctgcaacgggccgtaacggtgtcattgcgttctgcggtggcttccatggc
cgcacactgttagcttctgcgcttacgggtaaagtactgccttacaaagcaccttttggc
acgctaccgggtgaagtgtaccacatccccttccccgataatcatgacatcacggtggaa
gacagcttgaaaatgctgcacttcctatttgcggctgatatctcccccaacaatgtagct
gctattattattgagcccgtgcagggggaaggtggcttccgggttgcccctacagcactg
ctcaagcagcttcgcgctatttgtgaccagcacggcatcaaactgattgccgacgaagtg
cagagtggttttgcccgtactggcaagctgtttggaattgaacattccggcgtagaacca
gatctggtgtgcattgctaaatctctggcaggtggttttccactttccggtgtgattggc
cgtgcagaactgatggattctgttcctccgggcggtttgggcggcacatatgcaggtgcc
cctctgggttgtgcagcaggtttggccgtgctggacattattgaggaagaaaagctgctt
gaccgtgccaataacatgggtgaacgcctgaaggcccgtattgcaagctggcataagcgc
acagatatgctgcctatcagcatgccgcgtgggctgggcgcaatggttgcttttgatatt
ctggaacgccatgcgggtgtggaacagcgcaagggttttggttccaaactgtgtgcccgc
gcctgtgaaaaaggtctgattttgctggcatgtggtgtgcagggcgcaacaatccgtatt
ctgacaccgctgaccgcatctgatgaactggttgatgagggtctggatattatcgaacag
attctactggaagacgcaaaagcctga

DBGET integrated database retrieval system