KEGG   Actinobacillus porcitonsillarum: DDU33_02420Help
Entry
DDU33_02420       CDS       T05443                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
apor  Actinobacillus porcitonsillarum
Pathway
apor00550  Peptidoglycan biosynthesis
apor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apor00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DDU33_02420
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:apor01002]
    DDU33_02420
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:apor01011]
    DDU33_02420
Enzymes [BR:apor01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DDU33_02420
Peptidases and inhibitors [BR:apor01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   DDU33_02420
Peptidoglycan biosynthesis and degradation proteins [BR:apor01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   DDU33_02420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 tRNA-synt_1_2
Motif
Other DBs
NCBI-ProteinID: AWI50419
UniProt: A0A2U8FHG3
LinkDB All DBs
Position
complement(477560..478738)
Genome map
AA seq 392 aa AA seqDB search
MKKTLLKSVSLCAMALSSFAYADVNTDFGISAPQLNAQTYILMDYNSGAVLASLNPDQRQ
YPASLTKMMTAYVVGDAIKQGKVRNSDMVTVTENSWAQKFPGSSLMFLDLNTQVSVGDLM
KGLIIVSGNDAAVALAEHTSGSQQAFIDQMNKYAQQFGLKNTYFTTVHGLDDPNQFSSAH
DMAIIGAHVIRDQPEEYKIYAEKEFKYNIKKPQPNRNGLLWDKTMNVDGMKTGHTDKAGY
NLVASATNANTRLISVVMGVPTYKGREVESKKLLQWGFANFETVKSLPAGQAIKEESVYY
GNANKVQLGSVQDSFITIPKGKTADLKARYELDSKSLEAPLAKGQVVGKVIYQLDGKDVA
SSPLQALQDVQEAGIFGKAWDWLVLTVKSLFN
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacattattaaaatcggttagcctttgtgctatggcgctttcttcttttgct
tacgcagatgtgaatacagattttggcattagtgcaccgcaattaaatgcccaaacctat
attctcatggattataactcgggtgctgtcttagcgagtttaaatccggatcaacgtcaa
tatcctgcctcattaaccaaaatgatgacagcttatgttgtgggcgatgcgattaaacaa
ggtaaagttcgcaatagcgatatggtaaccgtgaccgaaaattcttgggcgcaaaaattc
ccaggttcttcattaatgtttttagatttaaacacgcaagtttcggtgggcgatttaatg
aaggggctgattattgtttcgggtaatgatgcagcggttgccttagcggaacatacttca
ggttcacagcaagcatttattgaccaaatgaataaatatgcacaacagtttggtttaaaa
aatacttatttcactaccgtacacggtttagatgatccgaaccaattctcttcagcacat
gatatggcgattattggcgcacatgtgattcgtgatcaaccggaagaatataaaatctac
gcagaaaaagagtttaaatataacatcaaaaaaccacagccaaaccgcaacggtttattg
tgggacaaaacgatgaacgtagatggtatgaaaacaggtcatacagataaagcaggttat
aacctagtcgcttctgcaacgaatgcgaatactcgcttaatctcggtggtaatgggcgta
ccaacctataaaggccgtgaagttgaaagtaagaagctacttcaatggggctttgcgaat
tttgaaacggtaaaatcattaccggcgggtcaagcgatcaaagaagaaagtgtatattac
ggtaatgcgaataaagtccaacttggttctgttcaagatagctttattaccattccgaaa
ggaaaaacagccgatttaaaagcccgttatgagttagacagtaaaagcctagaagcgcct
ttagcaaaaggacaagtggtaggtaaagtgatttatcaacttgatggtaaagatgtggcg
agcagtcctctccaagcattacaagacgttcaagaagccggtatctttggtaaagcgtgg
gattggttggtgctaacggtaaagagtttgttcaactaa

DBGET integrated database retrieval system