KEGG   Actinobacillus porcitonsillarum: DDU33_09550Help
Entry
DDU33_09550       CDS       T05443                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
apor  Actinobacillus porcitonsillarum
Brite
Enzymes [BR:apor01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     DDU33_09550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AWI51712
UniProt: A0A2U8FL53
LinkDB All DBs
Position
complement(1977094..1977633)
Genome map
AA seq 179 aa AA seqDB search
MKKTLITLSLAFAVLPLSAQEKVAESLTVNVELLDPIKGNTAAGTVSITESKYGLVFTPS
LKGLTAGLHGFHIHENPSCEPKEKDGKLTAGLAAGGHWNPNKATGHGAPWSDEAHLGDLP
ALYVDHDGNSTNPVLAPRLKSLNEIKGKALMIHAGGDNHSDHPAPLGGGGARMACGVIK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacattgattacattaagtttagcatttgcggtgttgcctttatctgctcaa
gaaaaagttgcagaatcattaacggtaaatgttgaattattagatccgataaaagggaat
acggcagccggaactgtgtcgattacagaatcgaaatatggtttagtttttactccttcg
cttaaaggcttaacagcaggcttacatggttttcatattcatgaaaacccaagttgtgaa
cctaaagaaaaagatgggaaattaacagcaggccttgctgctggagggcattggaatcca
aataaagcaacagggcatggtgctccatggtctgatgaggctcatttaggtgacttgcca
gcgttatatgttgatcatgatgggaattcaaccaacccagtattagcacctcgcttaaaa
tcactaaatgaaattaaaggtaaagctttaatgattcatgctggtggagataatcactct
gatcatccagcaccattaggcggtggcggcgcaagaatggcttgtggtgtgattaaataa

DBGET integrated database retrieval system