Actinobacillus porcitonsillarum: DDU33_10500 Help Entry DDU33_10500       CDS       T05443                                  Name (GenBank) HU family DNA-binding protein   KO K05787   DNA-binding protein HU-alpha Organism apor  Actinobacillus porcitonsillarum Brite KEGG Orthology (KO) [BR:apor00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:apor03032]     DDU33_10500    03036 Chromosome and associated proteins [BR:apor03036]     DDU33_10500    03400 DNA repair and recombination proteins [BR:apor03400]     DDU33_10500 DNA replication proteins [BR:apor03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     DDU33_10500 Chromosome and associated proteins [BR:apor03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     DDU33_10500 DNA repair and recombination proteins [BR:apor03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       DDU33_10500 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 DUF2267 HU-CCDC81_euk_1 Arteri_nsp7a Big_11 HU-DNA_bdg NA37 Motif Other DBs NCBI-ProteinID:  AWI51881 UniProt:  A0A2U8FLG3 LinkDB All DBs Position 2196257..2196529 Genome browser AA seq 90 aa AA seqDB search MNKSELIDAIAAKAELSKKDAKAALEATLEAVSESLKAGDTVQLIGFGTFKVNERAARTG RNPRTGEEIKIAAAKIPAFVAGKALKDLVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaaagtgaattaatcgatgctatcgcagcaaaagcagaattaagcaaaaaagat gcaaaagcagctttagaagcaacattagaagcagtatctgaaagcttaaaagcaggcgat accgttcaattaatcggttttggtacattcaaagtaaatgagcgtgctgctcgtactggt cgtaacccacgtactggtgaagaaatcaaaattgcagctgcaaaaatcccagcattcgtt gcaggtaaagcattaaaagatttagtaaaataa

DBGET integrated database retrieval system