KEGG   Accumulibacter phosphatis: CAP2UW1_0156Help
Entry
CAP2UW1_0156      CDS       T00966                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
app  Accumulibacter phosphatis
Pathway
app00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:app00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CAP2UW1_0156
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:app02000]
    CAP2UW1_0156
Enzymes [BR:app01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CAP2UW1_0156
Transporters [BR:app02000]
 Other Transporters
  Pores ion channels [TC:1]
   CAP2UW1_0156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C Tom37
Motif
Other DBs
NCBI-ProteinID: ACV33515
UniProt: C7RJF1
LinkDB All DBs
Position
complement(185829..186446)
Genome map
AA seq 205 aa AA seqDB search
MSDLVFYTHPQSRGRIVRWMLEECEAPYQTEIVQYGLQMKTPPYTDINPMGKVPAIVHQG
RVVTECAAIIAYLADVFAAAALAPPAAQRQDYYRWLFFAAGPFEQATTNNALGFVVSEEK
QRMVGYGNLDLVVNTLARAVSAHPYIAGDHFSAADVYVGSQIGYGLQFGTLPDRAEFRDY
FARLENRPARLRATQMDDALINKPV
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacctggttttctatacccatccacaaagtcgtggccgtatcgtgcgctggatg
ctggaagagtgcgaagcgccttatcaaaccgaaatcgtgcaatacggtcttcagatgaaa
acgccgccgtacaccgatatcaacccgatgggcaaggtgccggcgatcgtgcaccagggg
agagtggtcacggaatgcgccgccatcattgcctatttggcagacgtgtttgcggcagcg
gccctggcaccgccagcggcgcagcggcaggattactatcggtggcttttcttcgccgcc
gggcctttcgagcaggcgacgaccaacaacgcgctgggcttcgtggtcagtgaggaaaag
cagaggatggtgggctatggcaatctcgacctggtggtcaatacgctggccagggccgtc
agtgcgcatccctatatcgctggcgaccacttctcggcggctgacgtctacgtcggctcg
cagattggctatggcctgcagtttggcaccttgcccgatcgcgccgagtttcgcgattac
tttgctcgcctcgagaacaggccagcccgtctgcgcgccacgcaaatggatgacgcactg
atcaacaagccggtgtga

DBGET integrated database retrieval system