KEGG   Accumulibacter phosphatis: CAP2UW1_0283Help
Entry
CAP2UW1_0283      CDS       T00966                                 

Definition
(GenBank) ribonuclease II
  KO
K01147  exoribonuclease II [EC:3.1.13.1]
Organism
app  Accumulibacter phosphatis
Brite
KEGG Orthology (KO) [BR:app00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:app03016]
    CAP2UW1_0283
Enzymes [BR:app01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.1  exoribonuclease II
     CAP2UW1_0283
Transfer RNA biogenesis [BR:app03016]
 Prokaryotic type
  3'processing and CCA adding factors
   3'processing factors
    CAP2UW1_0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNB
Motif
Other DBs
NCBI-ProteinID: ACV33640
UniProt: C7RK49
LinkDB All DBs
Position
343220..345136
Genome map
AA seq 638 aa AA seqDB search
MHVLFEEDGAFRTATIVADNDSSLQVETASGKRSKIKSTSVLLRYGEPAPAALLEQAEAL
AGSIEHDFLWECLGDGEFSFSDFANDYFGHVATPVEASALLLALHSAPIYFHRKGKGRFR
KAPPDILQAALAGLEKKRQQALSIERMIGELKAFSLPAEFSPLLGQLLYKPDRNRGETKA
LEAACLDTGLSAAHLLARCGAIRSAYDYHLQRFLLEQFPRGTDFPDVATPLLPSDLPRAD
VRAFSIDDAATTEIDDAFSLQTLPGLGWRVGIHIAAPSLGIAPGSPLDAIARERLSTVYM
PGAKITMLPDAAVDRFTLSSGRAAPAVSLYLTVTPDFEVTAHESRVEIVPVVANLRHHDI
EPLFNEQTIAAGLTDFAFRDELLTLWQLANACEGRRGKPSAMQGNHDYNFRIDGDLADAE
ACRVEISARRRGSPLDKLVAELMIVANSTWGGLLAAQGVAAIYRVQTGGKVRMSTAPQAH
EGLGVKQYAWSSSPLRRYVDLLNQWQLVACLNGDTPPFAARSDALFAAMRDFDLTYSAYA
DFQRSIERYWSLRWLRQQGLETIEATIVGRENLARLDHLPLVQRVPSAPELKPGQRICLR
IESIDYLTLELACRYVETLAVAGSPAIAADDEVLEAVD
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgcatgttctattcgaagaagacggggctttcagaacggccaccattgttgccgacaac
gactcttcgttgcaggtcgagacagcctcgggcaagcgcagcaagatcaagtcgacgagc
gtcctgttgcgctacggcgaaccggcgccggcggccctgctcgagcaggccgaagcgctg
gccgggagcatcgagcatgactttctctgggagtgtctgggtgacggcgaattttctttt
tctgattttgccaatgattacttcggccacgtcgccacgccggtcgaggcctctgcgctc
ctgctggccctgcattcggcgccgatctacttccatcgcaaaggcaaagggcgcttccgc
aaggcaccgcccgacatcctccaggccgctctcgccgggctcgagaaaaagcgccagcag
gccctgagcatcgagcggatgattggcgagctgaaggcgttctcgctgcccgccgagttt
tcaccgctgcttggccagttgctctacaaacctgaccgcaaccgcggcgagaccaaggcg
ctggaggcggcttgcctcgacaccggtctgtcggcggcgcatctgctggccaggtgcggg
gccatacgctcggcgtacgactaccacctgcaacgcttcctcctcgagcaattcccgcgt
ggcaccgactttcccgacgtggccacgccactgctgccgtcagacctcccgcgcgccgac
gttcgcgccttttcgatcgacgacgccgccaccaccgagatcgacgatgccttctcgctg
cagacgctgcccggtctcggctggcgggtcggcatccatatcgcggcgccgtcgctgggt
atcgcgccgggatcgccgctcgacgccatcgctcgcgaacggctatcgacggtctatatg
cccggcgccaagatcaccatgctgccggatgcggcggtcgatcgcttcaccctttccagt
ggccgtgcggcgccagccgtttcactgtacctgaccgtcacacccgatttcgaggtcacg
gcccacgagtcgcgcgtcgaaatcgttccggtcgtcgccaacctgcgccatcacgacatc
gagcccttgttcaacgagcagaccatcgccgccgggctgactgacttcgcttttcgcgat
gagttgctgaccctctggcaactggccaatgcctgcgaaggcaggcgcggcaagccgtca
gcgatgcagggcaatcacgactacaacttccgcatcgacggtgaccttgccgatgccgag
gcgtgccgggtcgagatttccgcgcgccggcgcggcagtccgctcgacaagctggtcgcc
gagttgatgatcgtcgccaacagcacctggggcgggctcctcgccgcgcagggcgtggcc
gcgatctatcgcgtccagaccggcggcaaggtgcgcatgagcaccgcaccgcaggcgcat
gaaggccttggcgtcaagcagtacgcctggtcgtcatcgccgctgcgccgctacgtcgat
ctgctcaatcagtggcaactggtcgcctgtctcaacggtgatacgccgccgtttgcggcc
cgctcggatgcgctgtttgccgccatgcgcgatttcgatctcacctacagcgcctacgcc
gacttccagcgcagcatcgaacgttactggagtctgcgctggctgcgccagcaagggctg
gagaccatcgaggcgacgatcgtcggccgcgagaacctggcgaggctcgatcatctgcct
ctcgtgcagcgtgtaccgtcggcgccagagctcaaacccggccaaagaatctgcctgcgc
atcgagtcgatcgactacctgacactcgaactcgcttgccgttatgtggagaccctcgcc
gtggcgggaagcccggcaatagcggctgacgacgaagttctggaggcagtcgattga

DBGET integrated database retrieval system