KEGG   Accumulibacter phosphatis: CAP2UW1_0569Help
Entry
CAP2UW1_0569      CDS       T00966                                 

Definition
(GenBank) D-alanine/D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
app  Accumulibacter phosphatis
Pathway
app00473  D-Alanine metabolism
app00550  Peptidoglycan biosynthesis
app01100  Metabolic pathways
app01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:app00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CAP2UW1_0569
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CAP2UW1_0569
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CAP2UW1_0569
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:app01011]
    CAP2UW1_0569
Enzymes [BR:app01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CAP2UW1_0569
Peptidoglycan biosynthesis and degradation proteins [BR:app01011]
 Precursor biosynthesis
  Amino acid ligase
   CAP2UW1_0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_3 ATP-grasp_4 Neuropep_like ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ACV33918
UniProt: C7RLM4
LinkDB All DBs
Position
complement(683933..684859)
Genome map
AA seq 308 aa AA seqDB search
MNVRDFGKVAVLFGGRSAEREVSLNSGSRVLAALRRQGVDAHAFDPAERQLDDLAGFARA
FIALHGRYGEDGTIQGALELMGIPYTGSGVMASALGMDKWRTKLLWQAAGLPVPPYLMLD
DATDLAAVEAALGLPLFVKPACEGSSIGITKVKRPGELAAARAEAARHDSLVIAERAILG
GEYTVAILGNAALPIIKIEPSNEFYDYEAKYLRDDTAYRCPCGLTETRESELRQQALDAF
RVLGGRGWGRVDFLLDQAAAAGGGAAYFLEVNTSPGMTDHSLVPMAARAAGMSYDDLVVR
ILALATLG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtacgcgacttcggaaaggtggcagtactcttcggcggccgctccgccgaacgc
gaggtgtcgctgaacagtggttctcgcgttctggcggccttgcggcgccagggtgtcgac
gcgcacgcgttcgatccggcagagcggcagctcgacgacctggcgggcttcgcgcgggcc
ttcattgcattgcatggacgctacggcgaggacggcaccatccagggcgcgcttgaattg
atgggcattccctacactggcagcggcgtcatggcttccgcgctggggatggacaaatgg
cgaacgaagttgctctggcaggccgccggcctgccggttccaccttatctcatgctcgac
gacgcgaccgacctcgccgccgtggaagcggctctcgggctgccactgtttgtcaagccg
gcctgcgaaggctcgtcgatcggtatcacgaaagtcaaacgcccgggagaactggcagcg
gcgcgcgccgaagccgcccgccacgactcgctggtgatcgccgaacgcgcgatcctgggc
ggcgaatacaccgtcgccatcctgggcaacgcggcgctgccgatcatcaagatcgagccg
agcaacgaattctacgactacgaagccaagtacctgcgtgacgacaccgcctaccgctgc
ccttgtggcctcacggaaacccgtgagagcgaacttcgccaacaggcgctggacgctttt
cgcgtccttgggggccgcggctggggacgcgtcgacttcctgctcgaccaggcggcagcg
gctggcggcggtgcagcctactttctcgaagtgaatacctcgccaggaatgaccgaccac
tcgctggtgcccatggcagcgcgcgccgcaggcatgagctacgacgatctggtcgtccgc
atactggcacttgccacgctgggatga

DBGET integrated database retrieval system