KEGG   Accumulibacter phosphatis: CAP2UW1_0749Help
Entry
CAP2UW1_0749      CDS       T00966                                 

Definition
(GenBank) drug resistance transporter, Bcr/CflA subfamily
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
app  Accumulibacter phosphatis
Brite
KEGG Orthology (KO) [BR:app00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:app02000]
    CAP2UW1_0749
Transporters [BR:app02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    CAP2UW1_0749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: ACV34094
UniProt: C7RMR7
LinkDB All DBs
Position
871469..872752
Genome map
AA seq 427 aa AA seqDB search
MADSQLSPAPRGIAFMLAALAALGPFSIDTYLPSFHDIGASLHATPLQVQQTLTAYLLPF
ALMTLWHGAISDALGRRRVILVTVALFALASAGCMLATRIEHLWLLRALQGMTGGAGIVI
SRAIVRDLYDGPPAQRLISQITMMFAVAPAVAPVLGGWLQAWFGWRSVFAFLALSSAALW
LASWYLLPETLPRHRRQSLHAGYLVRSYWQVLTSRPFLLVCGALAFNFAAFFIYVLSAPV
FLMHHLGVAATGFLWLFGPAMGGLMIGAWLSGRCAGKLSLPRTIAAGYLVMGLAVVLNIG
LNLAWPPALPWSVLPIFVFTLGMSLAMPCLTLQALDLFPEKRGLAASCQGFLQAGFNAFA
AALIAPALWGSTLSLALGMGGLLLLGIFATLIHQRRSVCCLIRSACHRFPWQTAAGTARR
RCRRPSG
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtggccgattcgcagctctcgccggcgccgcgcgggattgccttcatgctggccgcgctg
gcggccctcggtcctttctcgatcgatacctacctgccgtcgtttcacgacatcggcgcg
tcgctgcacgccacgcccctgcaagtccagcagacgctgaccgcgtacctgttgccgttc
gcgctgatgacgctgtggcatggcgcgatctcggatgccttgggccggcggcgggtgatt
ctcgtcacggtcgccctgtttgcgctggcctcggccggctgcatgctggcgacacgcatc
gaacacctctggttgctgcgggcgctgcaggggatgaccggcggtgccggtatcgtcatc
agccgggcgatcgttcgcgacttgtacgatgggccaccggcacagcgcctgatttcgcag
atcaccatgatgttcgccgtggccccggcggtggcgcccgtgctcggcggctggttgcag
gcctggttcggctggcgctcggtgtttgccttcctggcgctgagcagcgctgccctgtgg
ctggcctcctggtatctgctcccggaaacgctgccacggcatcggcgccagtcgctgcac
gccggctatctggtccgcagctactggcaggtactcacttcgcggccgttcctgctggtt
tgtggtgcactggcgttcaatttcgccgccttcttcatctatgtgctctcggccccggtc
ttcttgatgcaccacctgggcgttgcggcgaccggtttcctgtggctgttcggcccggcg
atgggcggcctgatgatcggcgcctggttgtcgggccgctgcgccggcaagttgtcgctg
ccgcgcacgatcgccgccggctacctggtgatgggtctcgccgtcgtgctcaatattggc
ctcaatctggcctggccgccagcgctgccgtggagcgtgctgccgatcttcgtattcacg
ctcggcatgtcgctggccatgccctgcctgaccctgcaggcgctcgatctgtttcccgaa
aagcgtggcctggcggcttcctgccagggcttcctgcaggccggattcaacgctttcgcg
gccgccttgatcgcccccgcgctctggggatcgacgctctctctggcgttgggcatgggc
ggcctgctgctgctgggtatcttcgccacgctgattcatcaacggcgaagcgtttgctgc
ctcatccggtctgcctgccaccggtttccctggcaaacggcagcaggcacagcgagacga
cgatgcaggcggccatcaggctga

DBGET integrated database retrieval system