KEGG   Accumulibacter phosphatis: CAP2UW1_1128Help
Entry
CAP2UW1_1128      CDS       T00966                                 

Definition
(GenBank) glycosyl transferase family 51
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
app  Accumulibacter phosphatis
Pathway
app00550  Peptidoglycan biosynthesis
app01100  Metabolic pathways
app01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:app00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CAP2UW1_1128
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    CAP2UW1_1128
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:app01003]
    CAP2UW1_1128
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:app01011]
    CAP2UW1_1128
Enzymes [BR:app01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     CAP2UW1_1128
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CAP2UW1_1128
Glycosyltransferases [BR:app01003]
 Polysaccharide
  Bacterial polysaccharide
   CAP2UW1_1128
Peptidoglycan biosynthesis and degradation proteins [BR:app01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   CAP2UW1_1128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ACV34460
UniProt: C7RQW2
LinkDB All DBs
Position
complement(1287835..1290237)
Genome map
AA seq 800 aa AA seqDB search
MASSIRSLLGELKNLATRIAPGLSSRFAGTLDSLRQPTRRGVIRTLLAVPALLLLYVLIL
IPFTPSISNIRKASSEHPAQILSADGKRLTEFKQSNREWVALAEISPYVINALIATEDHR
FYDHFGLDWRRTAAAALNSLRGDRQGGSTLTQQLARNLYPEEIGRAPTLTRKIKEAITAL
KIEAIHSKDEILETYLNTVPFLYNAYGIEMAARTYFDTSADRLDVLQSATLVGMLKGNSY
YNPVLNPERALQRRNTVLRQMVKREKLTPKQFDSLSKRPMRIDFERQTEPPGPAPHFARQ
LRKWLIAWADRNDYSIHGDGLVVRTTIDSRLQAAANQAVTRQGNSLQNIANAAWGKRSAW
GTDSSLVQAFIRESPEYAAAIAKDRTPAQAMLELQADKDFMRALRQQKTQIQIGFLAIDP
RNGHIKAWVGSRDFEQEAFDHVQQARRQPGSTFKPFVYGEAYRQGASPDDRLIDQAVEIA
VGGSEVWRPTDGAAPSGEAMSLSDGLAYSKNTITAQLIQQVGPAKVARLARHMGVRQSKL
EAVPSLALGTSPVTLKEMVAAYGTIANGGGYLEPLLVSRIEDRDGRVIEEFSPQDPDIAL
EPDVAYTLIDNLRGAINRGTGRDIRSRYGIRADVAGKTGTTQDNADGWFILMHRQLVAGA
WVGFNDSRVTLRSDYWGQGAHSALPVVGDFFGNALRARLIDPRARFAAPEDTGLWARITG
WFRRLLSPEPVAEPRPQRIVKPAQKQQPREDPATPAPNVLPPQAQDDPLQEKIDQIMKES
DEAEQLPTDPAAAAKLEDSR
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atggcctcatcgatacgttccctgcttggtgaactgaaaaacctggcgacccggattgcc
ccgggcctttcgtcccgcttcgccggcacgctcgactcgctccgccagccgactcggcga
ggggtgatccggacactgctggcggtacctgcgctgttgctgctctatgtcctcatcctc
atcccgttcacgccaagcatcagcaacatccgcaaggcgtcatcggagcacccggcgcaa
atcctctcggcagatggcaagagactcaccgagttcaagcaatccaaccgggaatgggtc
gcactcgccgagatctcgccatatgtcatcaacgccctgatcgccacggaagatcaccgc
ttttatgaccatttcggtctcgactggcgacgcaccgctgccgcggcgctcaacagcctc
aggggcgaccgccaggggggctcgacgctcacccagcaactcgcccgcaacctctacccg
gaggagatcggccgggcgccgacgctgacccgcaagatcaaggaagccatcacggcattg
aagatcgaggccatccacagcaaggacgaaatcctcgagacctacctcaacaccgtaccc
ttcctctacaacgcctacggtatcgagatggcggcgcgtacctatttcgatacctcggcc
gaccggctcgatgtactgcagagcgcgacgctggtcggcatgctcaagggcaacagctac
tacaatccggtgctcaatcccgagcgagcgctgcagcgacgcaacacggtgctgaggcaa
atggtcaagcgcgagaaattgaccccgaaacaattcgactcgctcagcaagcggcccatg
cgtatcgacttcgagcgccagacggaaccgccgggaccggcaccccacttcgccaggcaa
ctgcgcaagtggctgattgcctgggccgaccgcaacgactacagcatccatggcgacggg
ctggtggtacgcacaaccatcgattcccggctgcaggcagccgccaaccaggccgtgacg
cgccagggcaacagcttgcagaacatcgccaacgcagcatggggaaagcgctcggcgtgg
ggcaccgactccagcctggtccaggccttcatccgcgaatcgccggagtacgccgccgca
atcgccaaagatcggacgcctgcacaggccatgctggaactgcaggccgacaaggacttc
atgcgggcgctgcgtcagcaaaagacgcagatacagatcggtttcctggccatcgacccg
cgcaacggccacatcaaggcctgggtcggcagccgcgacttcgagcaggaggccttcgac
catgtgcagcaggcacgccgccagcccggctcgaccttcaaaccctttgtttacggcgaa
gcctaccgccagggcgccagcccggacgacagactgatcgaccaggcggtggaaatcgcg
gtcggcggtagcgaggtctggcggcccactgatggtgcagcgccaagcggcgaggcgatg
agcctgagcgacgggcttgcctactcgaagaacaccatcaccgcgcaactcatccagcag
gtcggccccgccaaggtggccagactcgcccgccacatgggcgtgcgccagagcaagctc
gaagccgtgccatcgctcgccctgggcaccagtcccgtcactctcaaggaaatggttgcc
gcttacgggacgatcgccaatggcggtggctacctcgagccgctgctggtcagccgcatc
gaagaccgcgacggccgggtcatcgaggaattcagcccgcaagaccccgacattgcgctc
gaacccgacgtcgcctacaccctgatcgacaacctgcgcggcgcaatcaaccgcggcacc
ggccgagatatccgcagccgctatggcatccgcgccgacgtggccggcaagaccggcacg
acgcaggacaacgcggacggctggttcatcctgatgcaccgacagttggtcgccggggcg
tgggtcggtttcaacgacagtcgcgtcacgctgcgcagcgactactggggtcagggggcg
cacagcgccttgccggtggtcggcgactttttcgggaacgccctgcgcgctcgcctcatc
gatccacgtgctcgtttcgcggcaccggaggacaccggcctctgggcgcgcatcaccggc
tggttccgcagactcctgtcgccggaacccgtcgccgagcccaggccgcaacggattgtc
aaacccgcccaaaaacaacagcctcgcgaggacccggcgacgccggctccgaacgtattg
cccccccaggctcaggatgacccgctgcaggagaagatcgatcaaatcatgaaagagagc
gacgaagccgaacagctgcccaccgatccagcagcggcggcgaagctggaggactcgcgt
tga

DBGET integrated database retrieval system